NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36769.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36769.1 Public Mus musculus 13 Pik3r1 21 106 86 CCDS HistoryNCBI Gene:18708Re-query CCDS DB by CCDS ID:36769.1Re-query CCDS DB by GeneID:18708See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36769.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055518 ENSMUSP00000056774 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055518Link to Ensembl Protein Viewer:ENSMUSP00000056774Re-query CCDS DB by Nucleotide ID:ENSMUST00000055518Re-query CCDS DB by Protein ID:ENSMUSP00000056774
Original member Current member EBI,WTSI OTTMUST00000123661 OTTMUSP00000067463 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000123661Link to Vega Protein Viewer:OTTMUSP00000067463Re-query CCDS DB by Nucleotide ID:OTTMUST00000123661Re-query CCDS DB by Protein ID:OTTMUSP00000067463
Original member Current member NCBI NM_001077495.2 NP_001070963.1 Accepted alive Link to Nucleotide Sequence:NM_001077495.2Link to Protein Sequence:NP_001070963.1Re-query CCDS DB by Nucleotide ID:NM_001077495Re-query CCDS DB by Protein ID:NP_001070963Link to BLAST:NP_001070963.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001070963.1 724 P26450 724 100% 0 0

Chromosomal Locations for CCDS 36769.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 101684880 101685069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101686208 101686378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101686973 101687041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101687131 101687307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101687501 101687643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101688633 101688758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101688979 101689159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101689399 101689497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101690481 101690583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101701447 101701526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101701711 101701912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101702709 101702840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101708920 101708994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101709650 101709742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 101757326 101757659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2175 nt):
ATGAGTGCAGAGGGCTACCAGTACAGAGCACTGTACGACTACAAGAAGGAGCGAGAGGAAGACATTGACC
TA
CACCTGGGGGACATACTGACTGTGAATAAAGGCTCCTTAGTGGCACTTGGATTCAGTGATGGCCAGGA
A
GCCCGGCCTGAAGATATTGGCTGGTTAAATGGCTACAATGAAACCACTGGGGAGAGGGGAGACTTTCCA
GGA
ACTTACGTTGAATACATTGGAAGGAAAAGAATTTCACCCCCTACTCCCAAGCCTCGGCCCCCTCGAC
CG
CTTCCTGTTGCTCCGGGTTCTTCAAAAACTGAAGCTGACACGGAGCAGCAAGCGTTGCCCCTTCCTGA
C
CTGGCCGAGCAGTTTGCCCCTCCTGATGTTGCCCCGCCTCTCCTTATAAAGCTCCTGGAAGCCATTGAG
AAG
AAAGGACTGGAATGTTCGACTCTATACAGAACACAAAGCTCCAGCAACCCTGCAGAATTACGACAGC
TT
CTTGATTGTGATGCCGCGTCAGTGGACTTGGAGATGATCGACGTACACGTCTTAGCAGATGCTTTCAA
A
CGCTATCTCGCCGACTTACCAAATCCTGTCATTCCTGTAGCTGTTTACAATGAGATGATGTCTTTAGCC
CAA
GAACTACAGAGCCCTGAAGACTGCATCCAGCTGTTGAAGAAGCTCATTAGATTGCCTAATATACCTC
AT
CAGTGTTGGCTTACGCTTCAGTATTTGCTCAAGCATTTTTTCAAGCTCTCTCAAGCCTCCAGCAAAAA
C
CTTTTGAATGCAAGAGTCCTCTCTGAGATTTTCAGCCCCGTGCTTTTCAGATTTCCAGCCGCCAGCTCT
GAT
AATACTGAACACCTCATAAAAGCGATAGAGATTTTAATCTCAACGGAATGGAATGAGAGACAGCCAG
CA
CCAGCACTGCCCCCCAAACCACCCAAGCCCACTACTGTAGCCAACAACAGCATGAACAACAATATGTC
C
TTGCAGGATGCTGAATGGTACTGGGGAGACATCTCAAGGGAAGAAGTGAATGAAAAACTCCGAGACACT
GCT
GATGGGACCTTTTTGGTACGAGACGCATCTACTAAAATGCACGGCGATTACACTCTTACACTAAGGA
AA
GGAGGAAATAACAAATTAATCAAAATCTTTCACCGTGATGGAAAATATGGCTTCTCTGATCCATTAAC
C
TTCAACTCTGTGGTTGAGTTAATAAACCACTACCGGAATGAGTCTTTAGCTCAGTACAACCCCAAGCTG
GAT
GTGAAGTTGCTCTACCCAGTGTCCAAATACCAGCAGGATCAAGTTGTCAAAGAAGATAATATTGAAG
CT
GTAGGGAAAAAATTACATGAATATAATACTCAATTTCAAGAAAAAAGTCGGGAATATGATAGATTATA
T
GAGGAGTACACCCGTACTTCCCAGGAAATCCAAATGAAAAGAACGGCTATCGAAGCATTTAATGAAACC
ATA
AAAATATTTGAAGAACAATGCCAAACCCAGGAGCGGTACAGCAAAGAATACATAGAGAAGTTTAAAC
GC
GAAGGCAACGAGAAAGAAATTCAAAGGATTATGCATAACCATGATAAGCTGAAGTCGCGTATCAGTGA
G
ATCATTGACAGTAGGAGGAGGTTGGAAGAAGACTTGAAGAAGCAGGCAGCTGAGTACCGAGAGATCGAC
AAA
CGCATGAACAGTATTAAGCCGGACCTCATCCAGTTGAGAAAGACAAGAGACCAATACTTGATGTGGC
TG
ACGCAGAAAGGTGTGCGGCAGAAGAAGCTGAACGAGTGGCTGGGGAATGAAAATACCGAAGATCAATA
C
TCCCTGGTAGAAGATGATGAGGATTTGCCCCACCATGACGAGAAGACGTGGAATGTCGGGAGCAGCAAC
CGA
AACAAAGCGGAGAACCTATTGCGAGGGAAGCGAGACGGCACTTTCCTTGTCCGGGAGAGCAGTAAGC
AG
GGCTGCTATGCCTGCTCCGTAGTGGTAGACGGCGAAGTCAAGCATTGCGTCATTAACAAGACTGCCAC
C
GGCTATGGCTTTGCCGAGCCCTACAACCTGTACAGCTCCCTGAAGGAGCTGGTGCTACATTATCAACAC
ACC
TCCCTCGTGCAGCACAATGACTCCCTCAATGTCACACTAGCATACCCAGTATATGCACAACAGAGGC
GA
TGA


Translation (724 aa):
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYNETTGERGDFP
G
TYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQQ
ALPLPDLAEQFAPPDVAPPLLIKLLEAIE
K
K
GLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVHVLADAFKRYLADLPNPVIPVAVYNEMMSLA
Q
ELQSPEDCIQLLKKLIRLPNIPHQCWLTLQYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASS
D
NTEHLIKAIEILISTEWNERQPAP
ALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDT
A
DGTFLVRDASTKMHGDYTLTL
RKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
D
VKLLYPVSKYQQ
DQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNET
I
KIFEEQCQTQERYSKEYIEKFKREGNEKEIQ
RIMHNHDKLKSRISEIIDSRRRLEEDLKKQAAEYREID
K
RMNSIKPDLIQLRKTRDQYL
MWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
R
NKAENLLRGKRDGTFLVRESSKQGCYACSV
VVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQH
T
SLVQHNDSLNVTLAYPVYAQQRR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser