NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36737.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36737.1 Public Mus musculus 13 Adgrv1 21 106 86 CCDS HistoryNCBI Gene:110789Re-query CCDS DB by CCDS ID:36737.1Re-query CCDS DB by GeneID:110789See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36737.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000095585 ENSMUSP00000093245 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000095585Link to Ensembl Protein Viewer:ENSMUSP00000093245Re-query CCDS DB by Nucleotide ID:ENSMUST00000095585Re-query CCDS DB by Protein ID:ENSMUSP00000093245
Original member Current member EBI,WTSI OTTMUST00000081991 OTTMUSP00000043923 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081991Link to Vega Protein Viewer:OTTMUSP00000043923Re-query CCDS DB by Nucleotide ID:OTTMUST00000081991Re-query CCDS DB by Protein ID:OTTMUSP00000043923
Original member Current member NCBI NM_054053.4 NP_473394.3 Accepted alive Link to Nucleotide Sequence:NM_054053.4Link to Protein Sequence:NP_473394.3Re-query CCDS DB by Nucleotide ID:NM_054053Re-query CCDS DB by Protein ID:NP_473394Link to BLAST:NP_473394.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_473394.3 6298 Q8VHN7-1 6298 99.6666% 0 21

Chromosomal Locations for CCDS 36737.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 81095383 81095501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81103219 81103396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81106903 81107091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81155155 81155276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81182646 81182803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81270744 81270922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81283356 81283472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81374182 81374282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81382220 81382380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81385888 81386027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81386712 81386961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81391616 81391800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81397167 81397574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81405164 81405406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81413047 81413218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81414574 81414691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81418996 81420098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81422129 81422264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81424223 81424397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81427603 81427746 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81433425 81433898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81435560 81435709 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81437469 81437705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81439413 81439632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81440048 81440243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81442466 81442614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81444346 81444578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81444850 81445035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81445213 81445351 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81446379 81446499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81448835 81448952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81459676 81459840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81466162 81466341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81472396 81472578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81472883 81473059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81474932 81475134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81476481 81476736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81479629 81479775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81481313 81481517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81481849 81482071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81487852 81487974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81488907 81489171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81492457 81492564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81492874 81493020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81493115 81493272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81494574 81494698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81496192 81496367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81498985 81499247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81503003 81503144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81503854 81503992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81504092 81504170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81506099 81506192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81508656 81508819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81509366 81509545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81510850 81510949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81511495 81511625 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81517953 81518162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81520503 81521314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81522105 81522286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81523536 81523780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81524559 81524774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81525314 81525529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81528449 81529058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81531567 81531706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81533011 81533091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81536310 81536439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81539959 81540161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81543369 81543549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81544468 81544644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81556950 81557323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81558920 81559651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81560650 81560864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81561454 81561580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81563564 81563830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81564982 81565105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81566262 81566425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81567331 81567511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81568337 81568522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81568608 81568734 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81573215 81573438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81574959 81575135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81578063 81578392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81578720 81578996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81579285 81579850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81581692 81581805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81584041 81584145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81592558 81592653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81592990 81593139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81595177 81595358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 81633007 81633028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (18897 nt):
ATGTCGGTGACCTCAGAACCAGGGATGATCTCTTCATTTTTACTAGTATACCTGTCAACCTTGTTCATCT
CT
TTTGTATTTGGAGAAGCGGAAATAAGATTCACTGGACAGACAGAGTTCTTCGTTAATGAGACAAGTAC
C
ACAGTTATTCGTCTTGTCATTGAGAGGATAGGCGAGCCCGCAAATGTTACTGCCATTGTGTCGCTGAGC
GGA
GAAGACACTGGTGACTTTTTTGATACATACGCCGCAGCGTTTATCCCTGCCAGAGGAACAAACAGGA
CA
GTGTACATAGCAGTATGTGACGACGATCTTCCGGAGCCTGATGAAACCTTCACATTTCACTTGACATT
A
CAGAAACCCTCAGCAAATGTGAAACTTGGATGGCCAAGGGCTGCTTCTGTGACAATCCTATCAAATGAC
AAT
GCATTTGGAATCATTTCCTTTAGTACGCCCTCATCAATCTCGGTGATTGAGCCAAGGAGCAGAAATG
CA
TCTGTACCTCTTACTCTCATCAGAGAAAAAGGGACCTATGGAATGGTCACCGTGACTTTTGATGTATC
A
GGTGGCCCAAATCCCCCTGAGGAAGACTTGAATCCAGTTAGAGGAAATATCACCTTCCCACCTGGCAGA
GCA
ACTGTGATTTACAACGTGACAGTTCTTGATGATGAGGTACCAGAAAATGATGAACTATTTTTGATTC
AA
CTGAGAAGTGTAGAAGGAGGAGCAGAGATTAATGCTTCTAGGAGCTCGGTTGAAATCATTGTGAAGAA
A
AATGATAGTCCTGTGAACTTCATGCAGAGTGTTTACGTGGTTCCCGAGGACGACCACGTACTCACTATT
CCC
GTGCTTCGTGGGAAGGATAGTGATGGAAATCTCATTGGATCTGATGAAACCCAAGTGTCAATCAGAT
AC
AAAGTAATGACTTGGGATTCAACAGCACATGCCCAGCAAAACGTTGACTTTATTGATCTTCAGCCGGA
T
ACTACTCTTGTCTTTCCCCCTTTTGTTCATGAATCACACCTGAAATTTCAGATAATCGATGACCTTATA
CCC
GAGATAGCTGAGTCATTTCACATCATGTTACTAAAGAACACCTTACAGGGAGATGCTGTGCTAATGG
GC
CCTTCTACAGTACAGGTCACCATTAAGCCAAATGACAAGCCCTATGGAGTTCTTTCATTCAATAGTAT
T
TTGTTTGAAAGACCAGTTATAATTGATGAAGATACAGCATCCAGTTCTAGATTTGAAGAAATTGCAGTG
GTT
AGAAATGGTGGCACACATGGGAATGTCTCTGTGAGCTGGGTGTTGACACGGAACAGCAGTGATCCCT
CA
CCAGTGACCGCAGACATCACCCCTGCTTCTGGGACTCTGCAGTTCGCACAAGGGCAGATGCTGGCGCC
A
ATTTCTCTAGTGGTCTTTGACGATGATCTTCCAGAAGAGGCTGAAGCTTACTTACTTACAATCTTGCCT
CAC
ACCATACAAGGAGGCGCTGAAGTGAGCGAGCCAGCGCAGCTTCTGTTCTACATTCAGGACAGCGATA
AT
GTTTATGGAGAAATAGCCTTTTTTCCTGGGGAAAGCCAGAAGATTGAAAGCAGCCCTAGTGAGCGATC
C
TTATCCCTGAGTTTGGCGAGACGTGGGGGAAGTAAAGGAGACGTGAGGGTGATTTATTCTGCACTTTAT
ATT
CCTGCTGGAGCTATGGACCCCTTGCGAGCAAAAGATGGCATCTTAAATACATCTAGGAGAAGCAGCC
TC
CTTTTCCCAGAACAGAACCAACAAGTTTCTATAAAATTACCGATAAGGAATGATGCATTCCTCCAGAA
T
GGGGCCCACTTCCTAGTGCAGTTGGAAGCTGTGGTGTTGGTGAACATATTCCCTCCGATTCCACCAGTA
AGT
CCCAGATTCGGAGAAATCAGAAATATTTCATTACTGGTTACCCCAGCCATTGCAAATGGAGAAATTG
GC
TTTCTTAGCAACCTTCCAATTATTTTGCATGAACCCAAAGATTCTTCTGCTGAGGTGGTATCTATCCC
C
TTGCATCGAGATGGAACTGATGGCCAGGCTACCGTGTACTGGAGTTTGCGGCCCTCTGGCTTTAATTCA
AAA
GCAGTGACTTTGGATGACGCAGGTCCTTTTAATGGCTCTGTTGTGTTTTTATCTGGACAAAACGAAA
CA
TCAATCAACATTACTGTCAAAGGCGATGACATACCGGAGTTGAATGAAACTGTAACCCTTTCTCTAGA
T
AGGGTGAGCGTGGACAGTGACGTCCTAAAATCAGGCTATACTAGCCGAGACTTGATTATTTTGGAAAAT
GAT
GACCCTGGAGGCATTTTTGAATTTTCTTATGATTCTAGAGGACCCTATGTTATAAAAGAAGGAGATG
CC
GTGGAGCTCCGGATTACTCGGTCCAGGGGGTCGCTTGTTAAACAGTTCCTCCGCTTTCACGTGGAACC
C
AGAGAGAGCAATGAATTCTATGGAAACATGGGGGTGCTAGAATTCACCCCAGGAGAACGGGAAGTAGTG
ATC
ACCCTCCTCACCAGACTGGATGGCACACCAGAGTTGGACGAGCACTTCTGGGTGATCCTCAGCAGCC
AT
GGTGAGAGAGAGAGCAAGCTGGGCTGTGCTACACTCGTCAACATAACGATTCTCAAAAACGACTATCC
T
CATGGGATTATAGAATTTGTTTCCGATGGTTTGAGTGCATCGATAAAAGAGAGCAAAGGGGAGGATATC
TAT
CATGCTGTTTATGGTGTAATACGAACTCGAGGCAACTTTGGTGCTGTTAATGTATCATGGATGGTTA
GT
CCAGACTTTACGCAAGATGTATTTCCTGTGCAAGGAACTGTTTGTTTTGGAGACCAAGAATTTTTTAA
A
AACATCACTGTCTACTCCCTTGTAGATGAAATTCCAGAGGAGATGGAAGAATTCACCATTATCCTACTT
AAT
GCCACTGGAGGAGCTCAAACAGGGATCAGGACAACTGCCTCCCTGAGGATTCTCAGGAACGATGACC
CC
GTTTACTTTGCAGAGCCTTGTGTTTTGAGGGTCCAGGAGGGTGAGACTGCCAACTTTACAGTTCTCAG
A
AATGGATCTGTTGACGGGGCCTGCACTGTCCAGTATGCTACCGTGGATGGGAAGGCTTCAGGAGAAGAG
GGA
GACTTCGCTCCTGTGGAGAAGGGAGAAACTCTTGTGTTTGAAGTTGGAAGCAGAGAGCAGAGTATAT
CT
GTACATGTCAAGGATGACGGAATCCCAGAAACAGATGAGCCTTTTTATATAGTCCTGTTCAACTCAAC
A
GGTGACACAGTGGTTTATGAGTACGGGGTAGCTACAGTCATAATTGAAGCCAACGATGACCCAAATGGT
GTT
TTCTCTCTGGAGCCCATAGACAAAGCAGTGGAAGAAGGAAAGACAAATGCATTTTGGATTTTACGGC
AC
CGAGGACACTTCGGCAATGTTTCTGTGGCTTGGCAGCTGTTCCAGAATGCTTCTCTGCAGCCTGGACA
A
GAGTTCTATGAAACATCAGGGACTGTTAACTTCACAGATGGAGAAGAAACAAAACCAGTCATTCTCCGT
GCT
TTCCCAGATAGGATTCCTGAATTCAATGAATTTTATATTCTAAGGCTTGTAAATATTTCAGGTCCTG
GA
GGTCAACTAGCAGAAACCAACTTTCAGGTGACAGTCATGATTCCATTCAATGACGATCCGTTTGGAAT
T
TTCATCTTAGATCCAGAGTGTCTAGAGAGAGAAGTAGCTGAAGATGTCCTCTCAGAAGACGACATGTCT
TAC
ATCACCAGCTTCACCATTTTGAGACAACAGGGTGTCTTTGGTGATGTACGGGTTGGCTGGGAAGTCC
TG
TCCAGAGAGTTTACTGCTGGCCTTCCACCAATGATAGACTTTATACTGCTAGGAAGTTTTCCAAGCAC
T
GTGCCTTTGCAACCACATATGCGACGTCACCACAGTGGAACAGACGTCCTGTACTTCAGTGGACTAGAG
GGT
GCATTTGGGACTGTTGATCCCAAGTACCAACCCTTCAGAAATAACACAATTGCCAACTTTACGTTTT
CA
GCTTGGGTAATGCCTAATGCCAACACAAATGGGTTTCTCATAGCAAAGGATGACAGTCATGGTAGCAT
C
TACTATGGAGTAAAAATCCAAACAAATGAAACCCACGTGACCCTTTCCCTTCATTATAAAACTTTTGGA
TCA
AATGTTACATATATTGCCAAGAGCACTGTCATGAAATATTTAGAGGAAGGTGTTTGGCTTCATGTTT
TA
ATCATCTTAGATGATGGCATAATTGAATTCTATCTGGACGGAAAGGCAATGCCCAGAGGCATAAAGAG
T
CTGAAAGGAGAAGCTATTACTGATGGTCCTGGGATCCTGAGAATTGGAGCAGGGATGGATGGTGGTGCC
AGA
TTCACAGGTTGGATGCAGGATGTGAGGACCTATGAGCGCAAGCTGACTCCCGAGGAGATTTACGAAC
TT
CATGCTGTGCCTGCAAGGACTGATTTACACCCGATTTCTGGGTATCTGGAGTTCAGACAAGGAGAAAG
T
AACAAGTCGTTCATTGTTGCTGCAAGAGATGACAGTGAAGAGGAAGGAGAAGAATTATTCCTTCTTAAG
CTG
GTCTCTGTGGATGGTGGGGCTCAGATTTCTAAGGAAAACACTACTGCTCGGCTAAGAATACAGAAAA
GT
GACAATGCCAATGGCCTGTTTGGCTTCACTGGGGCTTGTATACCAGAGATGACAGAGGAGGGGTCCAC
T
GTTTCCTGTGTGGTTGAGCGAACGAGGGGAGCTCTGGGTTACGTGCATGTTTTCTACACCATCTCCCAG
ATC
GAGTCAGAAGGCATCAATTACCTCGTTGATGATTTTGCCAATGCCAGTGGCACTATCACCTTCTTGC
CT
TGGCAGCGGTCTGAGGTCCTGAATCTGTACGTTCTTGATGAGGACATGCCTGAGCTAAATGAATATTT
T
CGGGTGACGTTGGTGTCTGCAGTTCCAGGAGATGGAAAACTTGGTTCAACTCCCATCAGTGGTGCCAGC
ATA
GATCCTGAGAAGGAAACCACAGGCATCACTGTCAAAGCTAGTGACCATCCTTACGGCTTGATGCAGT
TC
TCCACAGGGTTGCCTCCTCAGCCTGAAGATTCAATGAGTCTGCCTGCTAGCAGTGTGCCACATATCAC
A
GTGCAGGAAGAGGATGGCGAAATCCGTTTACTGGTCATTCGTGCACAAGGGCTCCTTGGTCGGGTGACT
GTA
GGATTTAGAACAGTATCCCTGACAGCATTTAGTCCAGAGGACTACCAGAGCACTGCTGGCACATTAG
AA
TTTCAATCAGGAGAAAGATATAAATATATATTTGTCAACATCACTGATAATTCCATCCCTGAACTGGA
A
AAATCTTTTAAAGTTGAGTTGTTAAACTTGGATGGAGGAGTGTCTGACCTCTTTAGGGTTGATGGCAGT
GGG
AGTGGAGAAGCGGACACGGATTTCTTCCTTCCACCTGTCCTCCCGCATGCCAGTCTAGGAGTGGCTT
CC
CAGATTCTGGTGACCATTGCTGCCTCTGACCATGCTCATGGGGTGTTTGAATTCAGCCCTGAATCACT
C
TTCGTCAGTGGAACTGAACCAGAGGATGGATACAGTACTGTCGTGTTAAATGTTACACGGACTCGGGGA
GCC
CTGTCTGCAGTGACTTTGCAATGGAAGGTAGACTCGGACCTGGATGGGGATCTCGCCATTACATCTG
GC
AACATCACATTTGAGACTGGGCAGAGGATTGCTTCCATCACTGTGGAGATACTGTCAGATGAAGAGCC
A
GAGCTAGACAAGGCACTCACCGTGTCGATCCTCAACGTGTCCAGTGGCTCCTTGGGAGTTCTTACAAAT
GCC
ACATTGACAATTTTGGCTAGTGATGATCCTTATGGGGTCTTTATTTTTCCTAACAAAACTAGACCTT
TG
AGTGTTGAAGAAGCAACCCAGAATGTCACATTATCGATAATAAGGTTGAAAGGCCTCATGGGAGAAGT
T
GCAGTCTCATATGCAACCATAGATGATATGGAAAAGCCACCGTATTTCCCACCTAATTTAGCTAGAGCA
ACT
CAAGGAGGAGATTACATATCAGCATCTGGATTGGCTCTTTTCAGAGCTAATCAGACTGAGGCAACAA
TC
ACTATTTCAATCCTAGATGATGCTGAACCAGAACGCTCAGAATCTGTGTTCATTGAACTTTTCAATTC
C
TCTTTAGTAGACAAAGTACAGAATCGCCCAATCCCACATTCTCCACGCCTTGGGCCTAAGGTGGAGACT
GTG
GCCCATCTCGTTATTGTTGCCAATGACGATGCATTTGGAACTGTGCAGCTGTCTGCAACATCTGTTC
AT
GTAGCAGAAAATCATGTTGGACCCATTATCAATGTGACTCGAACTGGAGGAACATTTGCAGATGTTTC
T
GTTAAGTTTAAAGCTGTGCCAATAACTGCAGCAGCGGGTGAGGACTATAGTATAGCATCTTCAGACGTG
GTC
TTGCTGGAAGGGGAAACCACTAAAGCTGTGCCAATATATATCATTAACGACATCTACCCTGAGCTGG
AA
GAAACCTTTCTTGTGCAGCTACTAAACGAAACAACAGGTGGAGCCACACTGGGGCCTCTGAGAGAGGC
A
GTCATTACCATAGAGGCGTCTGATGACCCCTACGGACTGTTTGGTTTTCAGAATACTAAATTTATTGTA
GAG
GAACCTGAGTTTAACTCAGTGAGGGTAAACGTGCCAATAATTCGAAATTCTGGGACACTCGGCAATG
TT
ACTGTTCAATGGGTTGCCATCATTAATGGACAGTTTGCTACTGGCGACCTGCGAGTTGTCTCAGGTAA
T
GTGACCTTTGCCCCTGGGGAAACCATTCAAACCTTGTTGTTAGAGGTCCTGGCTGACGACGTTCCGGAG
ATT
GAAGAGGTTGTCCAGGTGCAACTAGCTGCTGCCTCTGGCGGAGGTACAATTGGGTTAGATCGAGTGG
CA
AATATTGTTATTCCTGCCAATGATAACCCTTACGGTTCAGTAGCCTTTGTTCAGTCCGTTTTTCGTGT
C
CAAGAGCCTCTAGAGAGAAGTTCCTATGCTAACATAACTGTCAGGAGAAGCGGAGGACACTTTGGTCGC
CTG
CTGTTGTGCTATGGTACTTCTGATATTGATGTAGTGGCTCGTGCAGTTGAGGAAGGTGAAGATGTGT
TA
TCCTACTATGAATCACCGACTCAAGGGGTGCCCGACCCACTCTGGAGAACTTGGGTGAACGTGTCTGC
A
GTGGAGGAGACACAGTATACCTGTGCCACTTTGTGTCTCAAAGAACGTGCCTGCTCAGCGTTTTCAGTT
GTC
AGTGGTGCCGAGGGCCCTCGGTGCTTCTGGATGACGTCGTGGGTCAGCGGAACTGTGAACAGCTCTG
AC
TTCCAAACCTACAAGAAGAACATGACTAGGGTGGCCTCTCTTTTCAGTGGCCAGGCAGTTGCTGGTAG
T
GACTACGAGCCTGTGACAAGACAGTGGGCCGTGATACTGGAAGGTGATGAGTTTGCAAATCTCACTGTT
TCT
GTACTTCCTGACGATGCTCCCGAGATGGATGAAAGTTTCCTAATTTCTCTCCTTGAAGTTCACCTTA
TG
AACATCTCAGACAGTTTTAAAAACCAGCCAACCATAGGACATCCGAATACTTCCGCTGTGGTCATAGG
A
CTGAATGGCGATGCCTTTGGAGTATTCATTATCTACAGTGTTAGTCCCAATACCTCGGAAGATGGCTTA
TGT
GTGGAAGTGCAGGAACAGCCACAAACTTCTGTGGAACTGGTTATCTACAGGACAGGAGGCAGCCTGG
GG
CAGGTCATGGTCGAATGGCGCGTTGTTGGTGGAACGGCTACTGAAGGTTTAGATTTTATGGGTGCTGG
A
GACATTCTTACTTTTGCAGAAGGTGAAACCAAAAAGATGGCCATTTTAACCATTTTGGATGATTCTGAG
CCA
GAGGACAATGAAAGCATCCTTGTCCGTCTGGTGGCCACAGAGGGCGGAAGCAGAATCCTGCCCAGCT
CA
GACACCGTGACAGTCAACATCTTGGCAAACGACAATGTGGCAGGAATTGTCAGCTTTCAGACAGCTTC
C
AGATCTGTCATAGGCCACGAAGGAGAAATGTTGCAGTTCCATGTGGTAAGAACACCCCCAGGTCGAGGA
AAT
GTCACTGTCAACTGGAAAGTTGTTGGACAAAATCTAGAAGTCAATTTTGCTAACTTTACGGGCCAAC
TC
TTCTTCTCTGAGGGTACATTGAATAAAACAATATTTGTACATTTGTTGGATGACAATATTCCTGAGGA
G
AAAGAAGTATACCAGGTTGTTCTGTATGATGTCAAGACCCAAGGAGTGTCGCCAGCAGGAGTTGCTCTA
CTT
GATGCCCAGGGATATGCAGCTGTACTGACAGTGGAAGCAAGCGATGAGCCACACGGTGTTTTAAACT
TT
GCTCTCTCCTCAAGATTTGTTGTGCTCCAGGAGGCTAATGTAACAATTCAGCTCTTCGTCAACAGAGA
G
TTCGGATCTCTAGGAGCCATCAATGTCACGTATGCTACTGTTCCTGGAATAGTAAGTCTGAAAAACAAC
ACA
GAAGGCAACCTAGCAGAGCCAGAGTCTGACTTCATCCCTGTGGTGGGCTCTCTGGTTTTGGAGGAAG
GG
GAAACAACAGCAGCTATCAGTATCACTGTCCTCGAGGATGATATACCAGAGCTAAAAGAATATTTCTT
G
GTGAATTTAACTCATGTTGATCTCATTATGGCTCCTCTGACTTCATCTCCTCCCAGACTAGATTCAGAA
GGC
CTGACGGCACAGATTGTCATAGATGCCAATGACGGTGCCCAAGGCATGATTGAATGGCAGCGTAACA
G
A
TTTGAAGTGAATGAAACCGACGGCGTTGTAACACTGGTAGCGCAGAGGAGCAGAGCAGCCCTTGGCCA
G
GTGTCATTGTTTATGTATGCCCAGAACCTAGAGGCTCAGGCGGGGCTGGATTACATGTGCACTCCACAG
ATT
CTTCACTTCACTGATGGAGAAAGGTTTAAGCATGTGGACGTCATGATTCTGGACGATGACATGCCAG
AA
GGAGACGAAAGATTTCAGTTGCTATTAACAAATCCTTCTCCTGGACTAGAGCTGGGGAAAAATACCAT
A
GCTTTGATTACTGTCCTTGCCAATGACGATGGCCCTGGAGTTCTGTCCTTTAACAACAGCGGGCACATC
TTC
CTCAGGGAACCGACATCTCTCTACGTGCAGGAGAGTGTAGCAGTGTTAGTCATTGTTCGGGAACCAG
CT
CAAGGTCTGTTTGGAACAGTGGCAGTTCAGTTTGTTGTGACAGAAGTCAACTCTTCAACTGAATCGAA
G
GACCTGTCTCCTTCCAAAGGCTTTATTGTTCTAGAGGAAGGCGTTCGGTCCAAGACCCTGCGCATCTCT
GCC
ATATTAGACACGGAACCAGAAATGGACGAGCATTTTGTCTGCACCCTGTTTAATCCAACTGGAGGTG
CT
AGACTAGGGGCCCATGTTCAAACCTTGATAACAATTTTTCAAAACCAGGCTCCTTTGGGACTATTCAG
T
ATCTCTGCTGTTGAAAATAGTGCCACCTCTATAGATGTTGAAGAATCCAACAGGAGTGTGTACCTCAAT
GTG
TCACGTACAAATGGCCTTGACTTGACTGCGAGTGTGCAGTGGGAGACAGTATCTGAGACAGCCTTTG
GC
ATGAGGGGAATGGATGTCGTCTTTTCCATATTTCAAAGCTTTTTTGACAAGACAGCACTGGACTGGTG
T
TTCTTTACTGTTGAAGGCTCAGTTTACGGCGTAATGTTAAGAAAATCCTCATTAGTTGTTTATCGATGG
CAA
GGGACTTTTGTTCCTGTTGAGGACTTAAAGGTAGAAAGTCCTAAAACTTGTGAGGCCTTTAATATTG
GC
GTTTCCCCATATCTTGTGATTACTCATGGGGAAAGAAGTGGAGAGAAGCCTTCCATTAACAGTGTGTA
C
ATGCTCACTGCTGGATTCAGATTAGTCCTGATACAGACAATCATTATTTCAGGAAGCTGTCAAGTACGG
CAT
TTCACCTCAGACAGTCAAGACTATTTCATCATTGCAAGTCGAAGAAATGATTCCGAATTAACCCAGG
TC
TTCAGATGGAACGGAAACAACTTTGCCTGGCATCAGACACTGCCTGTCCGAGGTGTGCTGGGCATGGC
C
TTGTTCAGCAGAGGAGGCTCTGTCTTCTTAGCCATTTCTCAGGCTAACATCAGACAAACCTCCCTTTTG
TTT
ACGTGGTCTGGTACTCAGTTTATTAACTTTCAAGAACTGCCCATCAGTGGGATAACACAAGTTGAGG
CT
TTGTCCTCAGGCGATGATGTTTATTTATGTTTTGCCAAAAATACCTTTCTAGGAAATCAGAATGCAAT
T
GACATTTTTGTCTGGGAGATGGGGCATTCATCGTTGAGGTATTTCCAATCCCTGGACTTTGCTGCTGTT
AAG
AGAATCCGTTCCTTCACACCAGCTTCTGGCATAGTCCACATACTTCTAACTGCCCAAGACGGGTCTG
CT
CTTTACTGCTGGAACTCAGAGCTGAATGCCTTCTCTTTCGTCCTGGAAGCACCTGCTGCGCACGATGC
A
GCTTTTGTGACAGTGAAGTCGCTTAATTCAAGCAAGACTTTAATTGCTTTAGTGGGAGCCACTGACTCC
CAT
TTATATGAGTTGACCTACGTCTCCAGCCAGTCTGACTTTATTCCTAGTTTAGGTGAACTGATATTTG
AA
CCTGGCGACAAGGAAGCAATCATAGCAGTAAATGTCCTTGATGACACAGTTCCCGAAAAAGAAGAATC
A
TTCAGAGTTCAGCTTAAAAGTCCAAGAGGCGGAGCAGAGATTGGCATTAACAGTTCTGTGAGAGTCACT
GTT
CTCGCCAATGATGGTGCCTATGGAGTTGTAGCATTTGCCCAGAACTCACTGCATAAGCAATTGGAGG
AA
TTGGAACGAGATAGCCTGGTAACACTGAATGTTGAACGCTTGAGAGGAACACACGGCCGCATAACTGT
A
GCATGGGAAGCAGCCGGAAGTGTCAGTGATGTATTTCCCACCTCAGGAGTGATCTCATTCACAGAGGAC
CAG
GCAATGTCTATGATCACTCTGACTGTTCTTGCGGATGATCTGCCGGAGTTATCCGAGGCTGTGGTTG
TA
ACACTTACCCAGATTGTCACAGAGGGGGTTGAGGACCCATTGAAAGGTGCTACAATTGACCAGAGCAG
A
AGCAGGTCTGTGCTGACCATCCTGCCCAGTGACTCGCCCTACGGTGTGGTTCGCTGGCACACCGAGTCT
CTC
TTCAATAGAGTGCCAGAGCCCACAGAGAACATCACTGTCGTTCAGTTACATATTGTTCGAGACAAAG
GA
CTATTTGGGGACATTTCCATTCACTTGATAGCAAAACCCAATTTCTTATTACATATCAATAATCAAGC
T
ACTGAGGATGAAGATTTTGTATTGCAAGACTCAGTAATAATAATGAAAGAAAACATAAAAGAAACTCAT
GCT
GAAGTCGCCATTTTGCCAGATGAGGTTCCTGAGCTGGATGAAGGACTCATTGTCACCATCGCTGCAG
TG
AACCTGGTTAACCCCAACTTTCCTGCAGAGCAGCCCCGTGTGCAGAGACCAAGGATGGAGTCAGCGGA
G
ATACTGATTGAAGAAAACGATGATCCCAGAGGGATTTTTAACTTTCATGTTGTCAGAGATGTTGGTGGA
GTC
ATTATTGCTCATGAGGGGCCCCCGCCCTTGAATGTTCTTCAAGTTCCTGTTGTCCGGATGGCTGGAA
CC
TTTGAGACAGTGAATGTTTATTGGAAAGCAACACCAGACAGTGCTGGCCTGGAAGACTTTCAGCCATC
T
CACGGGATGCTCCAGTTTGCTGATGGACAAGTCATCGCACCAATACTTGTAACTATAATTGATGATTCT
GAG
TTTGAGCTCTTGGAAACGTTCACCATCTCCCTAGTGAGTGTGACTGGTGGCGGCCGACTAGGTGATG
AT
GTTTCGGTGAATGTTGTCATAGCACCGAATGACTCGCCCTTTGGAATATTTGGATTCGAAAAGAAAAC
T
GTAATGGTTGATGGACCGCTTTTGTCTGATGACCCTGATTCATATGTGACACTGACAGTCGTCCGGTCC
CCA
GGAGGAAAAGGAGCTGTCCGACTTCACTGGGCTATTGAAGAGAAGGCCAAAGATGACCTCAGTCCTT
TG
AATGGAACACTATATTTTGATGAGACTGAATCCCAGAAGTCTGTTATATTGCACACACTTAAGGACGG
C
ATGGTGGGGGAAGACAGGCGCTTCATTATTGAGCTGACAGCTGCTGATGAGGTAGAAATATCTCCAGTG
AAA
GGTAGCGCATCAGTCATCATCCGAGGAGATAAGAGCATATCAGAAGTTGGAATTGCTTCATCATCCA
GA
CACATCATTATTGGGGAACCCTCAGCCACATACAATGGCACTGCCATCATCGACCTTGTTCGTGGCCC
A
GGGGTTTCAGGGGAGATCACAGTGAACTGGAAGATATTGCCTCCTTCCAGGGGGGAGTTTGTGGAGACA
TCA
GGACAACTGACGATGCTGGATGGACAGACTGCTGCCACAGTAGTTATTCAGGCTTTGAATGATGACA
TC
CCAGAGGAGAAGTGTCACTATGAGTTTCAGCTCACTGAAATCAGTGAGGGTAGGATGCTGCATGAAGC
C
AGTGTCAGCGCCCGCATCACCATGGTGGCCAGTGACGCTCCCTATGGCCGGTTCTCATTTTCACATGAG
CAG
CTTCACGTTTCCGAAGCAGCACAGAGGGTTAATGTCACAGTGGTCCGCTCAGGCGGCTCCTTTGGAC
GT
GCACGAGTCTTGTATGAGACAGGTAGCAGGACGGCTGAGGCAGGCTGGGACTTTGTTCCTGCTTCTGG
G
GAGCTGCTCTTTGAAGCCAGAGAGAAGATGAAAAGTCTGTACATTGACATCCTTGATGACAACCTTCCT
GAA
GGCCCTGAGGAATTCGTTCTTGCCATTACAAGAGTGGACCTCCAGGGAAGAGGATATGATTTTACCA
TC
CAAGAGAATGGACTTCAGATAGATCAACCTCCTGAAATTGGGAACATCTCCATTGTTCGAATCATAAT
A
ATGAAAAATGATAATGCAGAAGGCATCATTGAATTTGATCCAAAGTATACTGACATCTCAGTGGAGGAA
GAT
GCCGGCGTGATCACACTCCCTGTCCTGAGGCTTCATGGAACGTATGGCCACGTGTCAGCTGATTTCA
GC
TCCCGGGGTTTCTCTGCAGTTCCAGGAGGCTACGTACTGCATGGCAGCTCGGTCACCTTTCAGCATGG
A
CAGAACCTAAGCTTTATAAATGTCTCCATCATCGATGACAATGGAAGTGAATTTGAGAAGCAGTTTGAA
ATT
CTGCTCATTGGAGCTACGGGAGGAGCGATCCTTGGGCGCCACCTAGTGAGCAAAATCACCATTGCCA
AA
AGTGACTCTCCCTTTGGCATCATACGATTTCTCAACCAAAGCAAAATTTCTCTTCCTAACCCCAGTTC
C
ACAATGGCTTTACACTTGGTGCTGGAGCGGACCGGAGGACTCCTGGGAGAGATTCAGGTGAGCTGGGAG
GTG
GTAGGGCCCGATGCTGAGGAACCGTTACCGCCACACAATGGAGACTTTGCAGACCCAGTGAGTGGGA
CA
GTCTCTTTTGGAGACGGAGAAGGTGGTGTGAGAAGCATCATCCTCAGAGTTTGTCCTCACGAAGAAAC
T
GAAGCTGAGGAGACTTTTATTGTTCAGCTCAAGCCTTTGAGAGAAGCGAAGTTAGATCCCAGAGCTAAA
GCT
GTTACGCTAACAATACAGAAGTTTGGGGATCCGAATGGAGTTATTCATTTTGCTCCCGAGTCTTTAT
CT
AAGAGAAGGTTCTCAGAGCCACCTCCGTCGGATGGACCCCTGCTCGTGTCCTTCCTCGTCACAAGGTC
C
AAAGGCACCTCTGGAGATATCAAGGTGCACTGGGAGCTAAGCAGCGAGTTTGACATCACTAGAGACTTT
CTT
TCCACACGAGGATTTTTCACCATCGCTGATGGAGAGAGTGACGCAAGCTTTGATGTCCACTTGCTGC
CA
GATGATGTCCCTGAGATAGAGGAGGAATACGCTGTCCAGCTTGTTTCTGTAGAGGGAGGTGCAGAACT
G
GACCTGGGAAAATGCACCGCGAGGTTCTCTGTGTCTGCCAATGACGACCCGCATGGTGTGTTTGCCCTG
TAT
TCAGATCGGCAGTCAGTCCTGATTGGACAGAACCTTGACAGATCCATCCAGATTAACATCACCCGGC
TC
GCTGGAGCGTTTGGTGCTGTGGCTGTCAGAGTTCAAATACTATCTGATAATAAAGAAGACCCAGTGGC
T
ACTGAAAATGAAGAGAGACAGCTGGTGATCACCGATGGTGCCAGATATAAAGTAGGCTTGGTGCCCTTG
AAG
AATCAGGTTTTCCTATCTCTGGGCTCTAATTTCACCCTGCAGTTGGTGTCAGTAAGGCTTCTGAGTG
GA
CCTTTCTATGGAATACCAACAATTCTCCAGGAAGCGAAGAATGCTATTCTCTCTGTTCCTGAGGAAGC
T
GCCAATTCCCAGGTTGGCTTTGAATCTGCTGCTTTCCAGCTCATGGACATCAAGGCCGGCACAAGCCAA
GTC
ATGGTCTCCAGGAAAGGGACATACGGCAGGCTCTCTGTGGCCTGGACCACAGGTTACGCCCCTGGCT
CT
GAAATTCCTGAGCCTATTGTCATTGGCAACATGACACCAACCCTGGGGAGCCTTTCTTTTGTGCATGG
A
GAAGAGAGGAAGGGAGTCCTGCTGTGGACATTTCCCAGCCCTGGCCGGCCAGAGGCATTTGTCCTTCAT
CTG
TCAGGCCTGAGGAGCAGTGCTGCTGGTGGAGCTCAGCTTAGATCAGGTTTCACTACTGCTGAAATTG
AA
CCCATGGGAGTCTTCCAATTTTCCCCTAGTTCAAGAAATATCACAGTGTCAGAGGATGCACAGACGAT
C
CGAATATGTGTGCAAAGACTCTTTGGGTTTCACGGTGACCTGATTAAAGTCTCCTACGAGACAACTGCA
GGA
AGTGCCAAGCCTCCAGAGGACTTCGAAGCTGTTCAGAAGGGGGAAGTTTTTTTCCAGAGATTCCAAC
CT
GAGATTGATTTTGAAATAACCATTATTAATGATCAGCTTCCTGAGATAGAAGAAACATTTTACATTAA
T
CTTACTTCAGTAGAAACCAGGGGGTTGGGGAAGGGGGGTGTGAATTGGAGACCTCGCCTAAATCCAGAT
CTC
AGTGTCGCAGTGGTCACCATAGTGGACAATGATGACTTGACTGGGGTAGCTGTTTCTGTCCCTGTGA
CA
GCAGGGACTGTGGCAGTTGACAGCACTCTCCTTGCCATGGAAACTGGTTCTACCACACACCCTAACAA
A
AGCAAGATAACCACCATTCCATATACCACGGAGGTGTTTGCCCCTGTTACAGAGACAGTAACTGTGTCT
GCC
ATCCCTGAGAAACTTGCTACTGCTCATAGTGTCATATCTGTGAAGCCTGATGTGGTCCCAGGAACTG
TT
CTTGCTTCAGTCTATGGAACCCTGAGTATCGGACCCCCCATTGTTTATGTGTCAGAGGAAATGAAGAA
T
GGGACTCTCAGTACTGCAGATATCCTTATCCAGAGGATGGGTGGGTTCGCAGGCAATGTCACCATAACA
GTG
AAGACTTTCGGCGGAAGATGTGCTCAGAAGGAACCCAGTGTGTGGCCCTTCCAGGATGTCTATGGAG
TT
GGCAACCTAACAACATGGGCATTCGAAGAAGAAGACTTTGAAGAACAATTGCTCACCCTCACATTCCT
C
TATGGGGAAAGAGAACGTAAAATCGCAGTTCAGATTTTGGACGATGATGAGCCCGAGGGGCAGGAATTC
TTC
TACGTGTTTCTCACAGACCCTCAAGGGGGAGCAGAGATTGTGAGGGGGAAGGACAGCACTGGGTTTT
CA
GCCTTTGCTGTCATCATTATCTCAGGGAGTGACCTCCATAATGGCATCATAGGCTTCAGTGAGGAGTC
C
CAGAGAGGCCTGGAACTGAGGGAAGGAGCTGATAAAAACAGCCAGCGCCTAGTAGTCACAAGGCAGCCA
AAC
AGGGCCTTTGAAGAAGTTCAGATCTTTTGGCGAGTCACACTTAACCAAACAGTCACCATTCTCCAGG
AG
AAGGGGCTAAACCTAACAGATGAACTCCGGTTTGTGGCAGGGGTCACAACTTGCACAGGAGGTCAAAC
G
CGATGCTTTATTCACCTTGAGCTCAACCCCAAGAAGGTGCATCAAGTTGAAATGCCTTTCTTTGTGGAG
CTG
TATGACGTCACTGCAGGGGCAGCTATAAACAACAGTGCTAGATTTGCTCCAATTAAACTTTCCAAGA
GC
GGTGCCCCTCAGAGCCTTGTTTCCTTCTCTGTGGGTTCTCGGCTGGCAGTGGCTCACAAGAAGTCTAC
T
TTGATCAGTTTGCAGGTGGCCAGAGATTCTGGGACAGGAATCATGATGTCTGTTAACTTTATTACCCAG
GAG
CTGAGGAGCGCTGAAACAGTTGGTCGGGTCCTCATATCTCCAGCTGTTTCTGGGAAGGATTTTGTGA
GG
ACAGAAGGCACATTGGTCTTCGAGCCTGGCCAGAAAAGTGCAGTGTTGGATGTTGTCTTAACACCAGA
A
ACAGGGTCTTTAAATAAATTTCCTAAACGCTTTCAGATTGTGCTTTTTGACCCAAAAGGTGGTGCCAGA
ATT
GATAAAGTGTATGGGACTGCCAACATCACTCTCATCTCTGATGCGGATTCACAAGCTGTCTGGGGGC
TT
GAAGACCTGCTACATCAGCCCCTACATGAAGATATTCTCAACAGAGTGCTCCATAACCTCAACCTGCG
A
GTAGCCACAGAGAGCACAGATGAGCAGCTCAGTGCTGTGATGCTCATCATGGAAAAGATAACAATGGAA
GGA
AGAAATCAAGCTTTCAGTATCAAAAGCCGAACTCTTTTGTATGAGCTCCTTTGTGTTCTAATTAACC
CA
AAGCGCAAAGACACTAGGGGATTCAGCCACTTTGTGGAGGTGGCTGAGCATTTTGCCTTTTCTCTGCT
G
ACTGATGTTACCTGTGGGTCGCCTGGTGAAAAAAGCAAAACCATCCTTGACAGTTGCCCATATCTGTCA
ATT
CTGGCTCTTCACTGGAACCCTCAACAGATCAATGGACACAAGTTTGAAGGGAAGGAAGGTGATTACA
TT
CAAATTCCAGAGAGGCTACTGGATGTCCCTGAGGCAGAAATGCTGGATGGGAAAAATGCATGCACATT
A
GTTCAGTTTGTGGAGTACAGCAGCCAGCAGTGGTTCATAGCAGGAGACAACCTTCCTGCCCTAAAAGAC
AAG
GTATTGTCTTTGAATGTGAAAGGTCAGAGTGCACAACCTCTGCCTAACAACAATGAGGTTCTCTACA
GG
ATTCATGCAGCTGAGCCTAGAGTTGTTCCTCATACATCTCGGTGTCTCCTCTGGAATCAGGCAGCTGC
C
AGCTGGTTGTCTGACAGCCAGTTTTGCAAAGTGGTTGAAGATGCTTCGGACTATGTGGAATGTGCCTGT
TCA
CACATGTCTGTGTATGCTGTCTACGCCCAGACTGACAACTCGTCGTCATACAATGAAGCTTTTTTCT
CT
GCTGGGTTGATATGCATCTCAGGTCTTTGCTTGGCTGTTGTTTCACACATGTTCTGTGCCCGACACTC
C
ATGTTTGCAGCTAAGCTTCTGACTCACATGATGGTGGCCAGCTTAGGAACCCAGATTTTGTTCCTGGCA
TCT
GCATATGCAAGTCCCCACCTCAGCGAGGAGAGCTGCTCCGCTGTGGCTGCTGTGGCGCATTACCTGT
AT
CTTTGCCAGTTTAGCTGGATGCTCATTCAGTCTGTGAACTTCTGGTACGTGCTGGTGGTGAGTGATGA
G
CACACGGAGAGGCGGTGCCTGCTCTTCTGCCTTCTCAGCTGGGGGCTTCCATCTTTCGTGGTGATTCTC
CTC
ATACTTATTTTGAGAGGAATCTATCATCGGAGCATGCCGCAGATCTATGGACTTATTCATGGTGACC
T
A
TGCTTCATCCCAAACATCTATGCTGCTCTGTTCACGGCTGCTCTTGTTCCTCTAATGTGCCTCGTGGT
G
GTATTTGTGGTGTTCATTCATGCCTACCAGCTGAAGCCGCAGTGGAAAGGTTATGATGACGTCTTCAGA
GGA
CGAACCAACGCAGCAGAAATTCCTCTGATTTTATATCTCTTCGCCCTGATTTCTATGACGTGGCTTT
GG
GGAGGACTGCATATGGCCTACAGACACTTCTGGATGTTGGTTCTCTTTGTCATTTTCAATAGTCTGCA
G
GGACTTTATGTTTTTGTGGTTTATTTCATTTTACACAACCAAACGTGTTGCCCTATGAAGGCCAGCTAT
ACA
GTAGAAATGAATGGTCACCCAGGACCCAGCACAGCCTTCTTCACTCCTGGGAGCGGAATACCTCCAG
CT
GGAGAGATAAACAAGTCTACCCAGAACCTCATCAATGCTATGGAAGAGGTGCCATCTGACTGGGAAAG
A
TCATCCTTCCAGCAGACCAGCCAGGCAAGCCCTGATTTGAAGACAAGTCCCCAGAATGGTGCCTCATTC
CCT
TCTTCTGGAGGTTATGGCCCGGGGTCCCTGATAGCCGATGAAGAGTCCCAGGAGTTTGATGACCTGA
TA
TTTGCATTAAAAACTGGTGCTGGTCTCAGTGTCAGTGACAACGAATCTGGTCAAGGAAGCCAGGAAGG
A
GGCACCCTGACTGACTCCCAGATTGTAGAACTCAGAAGGATACCAATTGCTGACACCCACCTCTGA


Translation (6298 aa):
MSVTSEPGMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNETSTTVIRLVIERIGEPANVTAIVSLS
G
EDTGDFFDTYAAAFIPARGTNRTVYIAVCDDDLPEPDETFTFHLTLQ
KPSANVKLGWPRAASVTILSND
N
AFGIISFST
PSSISVIEPRSRNASVPLTLIREKGTYGMVTVTFDVSGGPNPPEEDLNPVRGNITFPPGR
A
TVIYNVTVLDDE
VPENDELFLIQLRSVEGGAEINASRSSVEIIVKK