NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36721.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36721.1 Public Mus musculus 13 Adcy2 21 106 86 CCDS HistoryNCBI Gene:210044Re-query CCDS DB by CCDS ID:36721.1Re-query CCDS DB by GeneID:210044See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 36721.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022013 ENSMUSP00000022013 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022013Link to Ensembl Protein Viewer:ENSMUSP00000022013Re-query CCDS DB by Nucleotide ID:ENSMUST00000022013Re-query CCDS DB by Protein ID:ENSMUSP00000022013
Original member Current member NCBI NM_153534.2 NP_705762.2 Accepted alive Link to Nucleotide Sequence:NM_153534.2Link to Protein Sequence:NP_705762.2Re-query CCDS DB by Nucleotide ID:NM_153534Re-query CCDS DB by Protein ID:NP_705762Link to BLAST:NP_705762.2

Chromosomal Locations for CCDS 36721.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 68620720 68620872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68625788 68625912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68630910 68631024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68640710 68640817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68642457 68642603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68651868 68652026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68657367 68657451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68668470 68668639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68671893 68672012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68678478 68678615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68689261 68689345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68709993 68710090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68713058 68713127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68720704 68720784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68724264 68724307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68727792 68727968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68729207 68729339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68730238 68730396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68732078 68732205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68734624 68734735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68738548 68738696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68796530 68796679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68887959 68888120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68982347 68982544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68999074 68999295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3288 nt):
ATGTGGCAGGAGGCGATGCGGCGGCGCCGCTACCTGCGGGACCGCGCCGAGGCGGCGGCAGCAGCGGCGG
CG
GGCGGCGGCGAGGGGCTGCAGCGGTCCCGGGACTGGCTCTACGAGTCCTACTACTGCATGAGCCAGCA
G
CACCCTCTCATCGTCTTCCTGCTGCTCATCGTCATGGGCGCCTGCCTCGCCCTGCTCGCCGTCTTCTTC
GCG
CTCGGGCTGGAGGTAGAAGACCATGTGGCATTTTTAATAACCGTTCCCACTGCCCTGGCCATCTTCT
TC
GCCATATTCATTCTTGTCTGCATTGAGTCTGTGTTCAAGAAGCTTCTCCGAGTGTTCTCGCTGGTGAT
C
TGGATATGTCTGGTTGCCATGGGATACCTGTTCATGTGCTTTGGAGGGACCGTGTCTGCCTGGGACCAG
GTG
TCATTCTTCCTCTTCATCATCTTCGTGGTGTACACCATGCTTCCCTTCAACATGAGGGATGCCATCA
TC
GCCAGCGTCCTCACCTCTTCATCTCATACGATAGTGCTGAGTGTCTACCTGTCTGCAACACCAGGGGC
C
AAGGAGCACCTGTTCTGGCAGATACTGGCCAACGTGATCATTTTCATCTGTGGGAACTTGGCGGGAGCT
TAC
CATAAGCACCTCATGGAACTTGCCCTGCAGCAAACCTATCGGGACACATGTAATTGCATCAAGTCCC
GG
ATCAAGCTGGAATTTGAAAAACGGCAGCAGGAACGACTTCTGCTTTCCCTGCTGCCTGCTCACATTGC
C
ATGGAAATGAAGGCTGAAATCATTCAAAGGCTACAGGGACCCAAAGCAGGACAGATGGAAAACACGAAC
AAC
TTCCACAACCTGTATGTCAAGCGACACACCAACGTGAGCATATTATATGCTGACATTGTTGGCTTCA
CC
CGCCTTGCAAGCGATTGCTCCCCTGGTGAACTGGTCCACATGCTGAATGAACTCTTTGGGAAGTTTGA
T
CAAATTGCAAAGGAGAATGAGTGCATGAGAATTAAAATTTTAGGAGACTGCTATTACTGTGTTTCCGGG
CTC
CCGATATCTCTCCCTAACCATGCCAAGAACTGTGTGAAAATGGGACTGGATATGTGCGAAGCCATAA
A
G
AAAGTGAGGGATGCTACTGGGGTCGATATCAACATGCGCGTGGGAGTGCATTCTGGGAACGTTCTCTG
T
GGTGTGATTGGTCTCCAGAAGTGGCAGTATGACGTGTGGTCTCATGATGTTACTTTGGCCAACCACATG
GAA
GCTGGAGGAGTCCCTGGACGTGTTCACATTTCCTCAGTCACTCTGGAGCACTTGAATGGGGCTTATA
AA
GTGGAGGAAGGAGACGGTGAGATAAGAGACCCATATTTAAAGCAGCATTTGGTGAAAACCTACTTTGT
A
ATCAACCCCAAGGGAGAAAGACGGAGTCCTCAGCATCTCTTCAGACCTCGACACACTCTGGATGGAGCC
AAG
ATGAGAGCATCTGTCCGCATGACCCGGTACTTGGAGTCCTGGGGAGCAGCCAAGCCATTTGCACATC
TG
CACCACAGAGATAGCATGACCACAGAGAATGGGAAGATTAGCACCACGGATGTGCCAATGGGTCAACA
T
AATTTTCAAAATCGCACCTTAAGAACTAAGTCACAGAAGAAGCGATTCGAAGAAGAACTGAATGAAAGG
ATG
ATCCAAGCAATTGACGGGATCAACGCACAAAAGCAATGGCTCAAGTCAGAAGACATTCAAAGAATCT
CC
CTGTTTTTCTATAACAAAAATATAGAAAAAGAATATCGAGCCACTGCACTGCCAGCATTCAAGTACTA
C
GTGACCTGTGCCTGCCTCATCTTCCTCTGTATCTTCATTGTACAGATTCTTGTACTGCCAAAAACGTCC
ATC
CTTGGCTTCTCCTTTGGAGCTGCATTTCTCTCCCTCATCTTCATCCTCTTTGTCTGCTTCGCTGGAC
AG
CTTTTGCAATGCAGCAAAAAGGCCTCTGCCTCTCTCTTGTGGCTTTTGAAATCATCAGGCATCATAGC
C
AACCGCCCATGGCCACGGATCTCCCTCACGATCGTCACCACAGCTATCATACTAACCATGGCTGTGTTT
AAC
ATGTTTTTCCTGAGCAACTCTGAGGAGACAACCCTTCCGACTGCCAATGCATCTAATGCAAACGTTT
CT
GTCCCAGACAACCAGACAGCAATTCTTCATGCACGAAACTTGTTTTTCCTCCCGTACTTCATATACAG
C
TGCATTCTGGGTTTGATCTCCTGCTCCGTTTTCCTGAGGGTGAACTACGAGTTGAAAATGTTAATCATG
ATG
GTGGCACTCGTGGGCTACAACATCATTCTGCTCCACACCCATGCCCATGTCCTGGATGCATACAGCC
AG
GTCCTGTTTCAGAGACCAGGCATTTGGAAAGACCTGAAGACCATGGGCTCTGTGTCCCTCTCTATATT
C
TTCATCACGCTGCTCGTTCTGGGTAGACAGAGTGAATATTACTGTAGGTTAGACTTCTTGTGGAAGAAC
AAG
TTCAAAAAAGAGCGGGAGGAGATCGAAACCATGGAGAACCTAAACCGAGTGCTGCTGGAGAACGTGC
TA
CCTGCACACGTGGCTGAACACTTCCTGGCCAGGAGCCTGAAAAACGAGGAGTTGTACCACCAGTCCTA
C
GATTGTGTCTGTGTCATGTTTGCCTCCATTCCGGACTTCAAGGAATTCTACACGGAGTCAGATGTGAAC
AAG
GAAGGCTTGGAATGCCTCCGGCTCCTGAATGAGATCATCGCTGACTTTGATGATCTGCTTTCCAAGC
CG
AAGTTCAGTGGCGTTGAAAAGATCAAGACCATTGGTAGCACATACATGGCAGCCACGGGTCTGAGTGC
T
GTACCCAGTCAGGAGCACGCCCAGGAACCCGAGCGTCAATACATGCACATAGGCACCATGGTGGAGTTT
GCA
TACGCCCTGGTGGGGAAACTGGATGCCATCAATAAGCACTCCTTCAACGACTTCAAACTTCGAGTGG
GT
ATCAACCATGGACCTGTAATAGCTGGCGTCATAGGGGCTCAGAAGCCACAATATGACATCTGGGGCAA
C
ACTGTCAACGTCGCTAGTAGGATGGACAGCACCGGAGTCCTGGACAAAATACAGGTGACTGAGGAGACA
AGC
CTCATCCTGCAGACGCTTGGCTACACGTGTACATGTCGAGGTATCATCAACGTGAAGGGGAAAGGGG
AC
CTGAAGACGTACTTTGTAAACACCGAGATGTCACGGTCCCTTTCTCAGAGCAACTTGGCTTCCTGA


Translation (1095 aa):
MWQEAMRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMGACLALLAVFF
A
LGL
EVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRVFSLVIWICLVAMGYLFMCFGGTVSAWDQ
V
SFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVYLSATPGAKEHLFWQ
ILANVIIFICGNLAGA
Y
HKHLMELALQQTYRDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTN
N
FHNLYVKRHTNV
SILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSG
L
PISLPNHAKNCVKMGLDMCEAI
KKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHM
E
AGGVP
GRVHISSVTLEHLNGAYKVEEGDGEIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGA
K
MRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTT
DVPMGQHNFQNRTLRTKSQKKRFEEELNER
M
IQAIDGINAQ
KQWLKSEDIQRISLFFYNKNIEKEYRATALPAFKYYVTCACLIFLCIFIVQILVLPKTS
I
LGFSFGAAFLSLIFILFVCFAGQLL
QCSKKASASLLWLLKSSGIIANRPWPRISLTIVTTAIILTMAVF
N
M
FFLSNSEETTLPTANASNANVSVPDNQTAILHARNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIM
M
VALVGYNIILLHTHAHVLDAYSQVLFQ
RPGIWKDLKTMGSVSLSIFFITLLVLGRQSEYYCRLDFLWKN
K
FKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNE
ELYHQSYDCVCVMFASIPDFKEFYTESDVN
K
EGLECLRLLNEIIADFDD
LLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHAQEPERQYMHIGTMVEF
A
YALVGKLDAINKHSFNDFKLRV
GINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEET
S
LILQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNLAS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser