NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36629.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36629.1 Public Mus musculus 13 Serpinb9c 21 106 86 CCDS HistoryNCBI Gene:20707Re-query CCDS DB by CCDS ID:36629.1Re-query CCDS DB by GeneID:20707See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36629.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110284 ENSMUSP00000105913 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110284Link to Ensembl Protein Viewer:ENSMUSP00000105913Re-query CCDS DB by Nucleotide ID:ENSMUST00000110284Re-query CCDS DB by Protein ID:ENSMUSP00000105913
Original member Current member EBI,WTSI OTTMUST00000062655 OTTMUSP00000030926 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000062655Link to Vega Protein Viewer:OTTMUSP00000030926Re-query CCDS DB by Nucleotide ID:OTTMUST00000062655Re-query CCDS DB by Protein ID:OTTMUSP00000030926
Original member Current member NCBI NM_011453.6 NP_035583.1 Accepted alive Link to Nucleotide Sequence:NM_011453.6Link to Protein Sequence:NP_035583.1Re-query CCDS DB by Nucleotide ID:NM_011453Re-query CCDS DB by Protein ID:NP_035583Link to BLAST:NP_035583.1

Chromosomal Locations for CCDS 36629.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 33149978 33150385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 33151796 33151951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 33154399 33154541 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 33156360 33156477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 33156859 33156996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 33157708 33157824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGTTATGTAATAACAACCCTTCCAAAAATGTATGCTATTCTCCCATCAACATCTCCTCTGCTCTAGCTA
TG
TTCCTTTTGGGAGTGAAAGGAAACACCGAAATCCAGATATCTGAGGCAATTGGCTTAAACACAGCAAT
A
GACATTCATCAGAGCTTCCTGTGGATTCTCAATATCCTGAAGAAGCCAACCAGAAAGTACACCTTCAGA
ATG
GCCAATAGGCTCTTTGCAGAGAACACTTGTGAATTCCTCCCAACATTTAAGGAGCCCTGTCTTCAGT
TC
TATCACTGGGAGATGGAGCACCTCCCCTTCACCAAGGCTCCAGAGGAGGCCAGGAATCACATAAACAC
A
TGGGTCTGCAAAAATACAAAAGGGAAAATTCCAGAATTGTTGTCAAGTGGCTCGGTTGATTCAGAGACC
AGG
CTTGTACTTGTCAATGCCTTATATTTCAAAGGAAGATGGCATCACCAGTTTGACATAAAGTCCACCA
GG
AAAATGCCCTTTAAAATAAACAAGGATGAGGAAAGACCAGTGCAGATGATGTTTCAGGAAGACATGTT
T
AAGCTCGCCTATGTGAATGAGGTGCAGGTTCAAGTGCTGGTGCTGCCCTATAAGGGCAAGGAGCTGAGC
TTG
GTGGTCCTGCTCCCGGATGATGGTGTGGAACTCAGCAAGGTGGAAGGCAATCTCACTTTTGAGAAGT
TA
TCAGCTTGGACCAAACCAGACTATTTGAAGACCACTAAAGTTTTGGTTTTCCTTCCAAAATTTAAACT
G
GAAGATTATTATGACATGGAGTCCATCTTTCAGGACTTGGGAGTGGGGGATATTTTCCAAGGGGGCAAG
GCT
GACTTATCAGAAATGTCTCCAGAGAGAGGCCTGTGTGTGTCCAAGTTCATTCAAAAGTGTGTTGTGG
AA
GTTAATGAAGAAGGCACAGAAGCTACAGCAGCCACAGCTGATGATACTGTATGTTCAGCTGAAACTCA
T
GATGGCCAGACTTTCTGTGCTGACCACCCTTTCCTTTTCTTTATCAGGCACAACAAAACCAACAGCATC
CTG
TTCTGTGGCAGGTTCTCATTTCCATAA


Translation (359 aa):
MLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGLNTAIDIHQSFLWILNILKKPTRKYTFR
M
ANRLFAENTCEFLP
TFKEPCLQFYHWEMEHLPFTKAPEEARNHINTWVCKNTKGKIPELLSSGSVDSET
R
LVLVNALYFKGRWHHQFDIKSTRKMPFKINK
DEERPVQMMFQEDMFKLAYVNEVQVQVLVLPYKGKELS
L
VVLLPDDGVELSK
VEGNLTFEKLSAWTKPDYLKTTKVLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGK
A
DLSEMSPERGLCVSKFIQKCVVEVNEEGTEATAATADDTVCSAETHDGQTFCADHPFLFFIRHNKTNSI
L
FCGRFSFP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser