NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36571.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36571.1 Public Mus musculus 12 Inf2 21 106 86 CCDS HistoryNCBI Gene:70435Re-query CCDS DB by CCDS ID:36571.1Re-query CCDS DB by GeneID:70435See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 36571.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101029 ENSMUSP00000098591 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101029Link to Ensembl Protein Viewer:ENSMUSP00000098591Re-query CCDS DB by Nucleotide ID:ENSMUST00000101029Re-query CCDS DB by Protein ID:ENSMUSP00000098591
Original member Current member NCBI NM_198411.2 NP_940803.2 Accepted alive Link to Nucleotide Sequence:NM_198411.2Link to Protein Sequence:NP_940803.2Re-query CCDS DB by Nucleotide ID:NM_198411Re-query CCDS DB by Protein ID:NP_940803Link to BLink:NP_940803.2

Chromosomal Locations for CCDS 36571.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 112600003 112600393 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112601329 112601444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112601523 112601682 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112602178 112602211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112603081 112603222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112603712 112603853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112604014 112604862 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112605373 112605518 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112605794 112605855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112606244 112606346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112606973 112607058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112607495 112607595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112608329 112608399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112608477 112608584 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112608848 112608918 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112609673 112609793 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112610119 112610283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112610462 112610564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112610695 112610856 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112611410 112612036 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 112612548 112612603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3816 nt):
ATGTCTGTAAAGGAAGGCGCTCAACGCAAGTGGGCGGCGCTGAAGGAGAAGCTGGGGCCGCAGGACTCAG
AC
CCCACGGAAGCCAACCTGGAGAGCGCCGAGCCTGAGCTGTGCATCCGGCTGCTGCAGATGCCCTCGGT
G
GTCAACTACTCGGGCCTGCGCAAGCGCCTGGAGAGCAGCGATGGCGGCTGGATGGTGCAGTTCCTGGAG
CAG
AGCGGCCTGGACCTGCTGCTGGAGGCGCTGGCACGGCTGTCAGGGCGTGGCGTGGCCCGCATCTCGG
AT
GCCCTGCTGCAGCTCACCTGCATCAGCTGTGTGCGTGCTGTCATGAATTCACAGCAGGGCATCGAATA
C
ATCCTCAGCAACCAGGGTTATGTGCGCCAGCTCTCCCAGGCTCTGGATACCTCCAATGTAATGGTCAAG
AAG
CAGGTGTTTGAATTGCTGGCTGCTCTGTGCATCTATTCGCCTGAGGGCCACGCACTGACGCTCGATG
CC
CTGGACCATTACAAGATGGTGTGCAGCCAGCAGTACCGCTTCAGCGTCATCATGAGTGAGCTCTCGGA
C
AGTGACAACGTGCCCTATGTGGTCACCCTGCTCAGTGTGATCAACGCCATCATTCTGGGTCCCGAGGAC
CTC
CGCTCTCGTGCCCAGCTGCGGAGTGAGTTCATAGGGCTACAGCTGCTGGATATTCTGACCCGGCTAC
G
A
GACTTGGAGGATGCGGATCTGCTGATCCAGCTGGAAGCCTTCGAAGAGGCCAAAGCGGAGGACGAGGA
G
GAACTTCAGCGAATTAGCGATGGGATCAACATGAACAGCCACCAGGAAGTCTTTGCGTCCCTGTTCCAC
AAG
GTGAGCTGTTCTCCAGCGTCGGCCCAGCTGCTGTCAGTATTGCAGGGTCTCATGCACCTGGAGCCTG
CT
GGCCGCTCAGGCCAACTGCTCTGGGAGGCCCTGGAAAACCTGGTGAACCGGGCTGTGCTCCTGGCCAG
T
GATGCCCAGGCTTGCACCCTGGAGGAGGTGGTTGAACGACTGCTGTCCATCAAAGGGCGGCCCCGACCA
AGC
CCCCTGGACAAGGCCCACAAGAGTGTCCAGACCAACTCAGTCCAGAATCAGGGCAGTTCCTCCCAAA
AC
ACTACTACTCCCACAACTAAAGTGGAAGGCCAGCAGCCAGTAGTGGCTTCTCCCTGCCAACACGTGGG
C
AGCATCCAGAGCTCCAGTGTTGACATAGCGCCACAGCCAGTAGCCCTTGAGCAGTGCATAACAGCCTTA
CCT
CTACCTACCCCACCACTCTCCAGCTCCACCCCTGTGCTCCCTCCAACCCCACCCCCCCTGCCAGGCC
CA
GGGGCCACATCTCCCCTTCCCCCTCCCCCTCCCCCTTTGCCTCCCCCTTTGCCAGGCTCAGGGACCAC
A
TCTCCCCCTCCCCCTCCTCCTCCCCCTCCCCCCTTGCCACCCCCTCTGCCAGGCTCAGGGACCATATCT
CCC
CCTCCACCCCCACCCCCACCTCCCCTACCAGGTACAGGGGCTGTGTCTCCCCCACCCCCTCCGCCAC
TT
CCATCTCTGCCTGATTCCCACAAGACCCAGCCCCCGCCCCCACCCCCACTCCCTGGCATGTGCCCAGT
T
CCTCCCCCTCCCCCACTACCCAGAGCAGGCCAGATACCTCCACCTCCTCCCCTGCCTGGTTTCTCTGTC
CCC
TCCATGATGGGTGGTGTGGAGGAGATCATTGTGGCCCAGGTCGACCACAGCCTGGGCTCAGCCTGGG
TC
CCCAGTCACCGCAGAGTGAATCCACCCACACTGAGAATGAAGAAGCTGAACTGGCAGAAGCTGCCATC
C
AATGTGGCACGAGAGCGCAACTCCATGTGGGCCACACTGGGCAGCCCCTGCACAGCCGCAGTGGAGCCC
GAC
TTCTCCAGCATTGAGCAGCTGTTCTCCTTCCCCACGGCTAAGCCCAAGGAGCCCTCTGCTGCCCCCG
CC
AGGAAGGAGCCCAAAGAAGTCACTTTTCTGGACTCCAAGAAGAGCCTGAACCTCAACATCTTCCTGAA
G
CAATTTAAATGTTCCAATGAAGAAGTCACCAGCATGATCCAGGCTGGAGACACCAGCAAGTTTGATGTG
GAG
GTCCTCAAACAGCTTCTAAAGCTTCTTCCAGAGAAGCATGAGATTGAGAACCTACGGGCGTTCACTG
AG
GAGCGAGCCAAGTTGTCCAATGCTGACCAGTTCTATGTTCTGCTCCTGGACATTCCCTGCTACCCGCT
G
CGGGTGGAGTGCATGATGCTGTGTGAGGGAACGGCCATCGTCCTGGACATGGTGCGGCCCAAGGCCCAG
CTG
GTGCTCACTGCCTGCGAGAGCCTGCTCACCAGCCAGCGGTTGCCAGTCTTCTGTCAGCTGATCCTCA
AA
ATCGGGAATTTCCTCAACTACGGCAGCCACACGGGAGATGCAGATGGTTTCAAGATTAGCACCTTGCT
G
AAGCTCACAGAGACCAAGTCCCAGCAGAGTCGCGTGACGCTGCTGCACCACGTGCTGGAGGAAGTGGAG
AAG
AGCCACCCGGACCTCCTACAGCTATCCCGGGACCTGGAGCCACCCTCTCAAGCTGCAGGAATCAACG
TG
GAGATCATCCACTCAGAGGCCAGTGCCAACCTGAAGAAGCTTCTAGAAGCGGAGCGGAAGGTGTCCGC
T
TCCATCCCTGAGGTGCAGAAGCAGTACGCTGAGCGCCTCCAGGCCAGCATTGAGGCCTCTCAGGAGCTG
GAC
AAGGTATTCGACGCCATTGAGCAAAAGAAACTGGAGCTGGCTGACTACCTGTGCGAAGACCCCCAGC
AG
CTGTCCCTAGAGGACACGTTCAGCACCATGAAGACCTTCCGAGACCTCTTCACCCGTGCCCTGAAGGA
G
AACAAGGACCGGAAGGAACAGATGGCAAAAGCGGAAAGGAGGAAACAGCAGCTGGCGGAGGAGGAGGCC
CGG
AGGCCGAGGGACGAGGATGGGAAGCCTATCAGGAAGGGGCCTGGGAAGCAAGAAGAGGTGTGCGTCA
TC
GATGCCCTGCTGGCCGACATCAGGAAGGGCTTCCAGCTACGGAAGACAGCCCGGGGCCGGGGAGACAC
T
GAAGCAAGTGGCAGAGTGGCCCCCGCAGATCCTCCAAAGGCCACAGAGCCTGCAACTGCCAGCAATCCT
ACC
CAGGGCACAAACCACCCTGCTTCAGAGCCCTTGGATACCACAGCAGCTGACGAGCCGCAGGGCTGGG
AC
CTTGTGGATGCTGTAACCCCCAGCCCCCAGCCCTCCAAGGAGGAAGATGGTCCTCCAGCCCTGGAGAG
G
CGCTCCTCCTGGTATGTGGATGCCATTGACTTCCTGGACCCTGAAGATACCCCGGATGCCCAGCCCTCT
GAG
GGGGTCTGGCCAGTGACTCTGGGAGATGGTCAAGCTCTGAATCCCCTCGAGTTCTCTAGCAATAAGC
CT
CCTGGAGTCAAGAGCTCGCACCAGGACGCTACGGATCCTGAAGCCTTGTGGGGCGTCCACCGAACCGA
G
GCAGACAGCACCAGTGAGGGACCAGAGGATGAAGCTCAGCGAGGACAGAGCACCCACCTACCCCGCACA
GGC
CCCGGAGAGGATGAGGATGGAGAGGACACAGCCCCAGAATCTGCACTTGACACGTCCCTGGACAGGT
CC
TTCTCTGAGGACGCAGTGACAGATTCCTCAGGGTCTGGCACCCTCCCCAGGGTCCAAGGCCGGGTCTC
A
AAGGGGACGAGCAAGCGGAGGAAGAAACGTCCCTCAAGGAACCAAGAAGAGTTTGTCCCTGATTCTGAT
GAT
ATTAAGGCAAAAAGGCTGTGTGTGATCCAGTGA


Translation (1271 aa):
MSVKEGAQRKWAALKEKLGPQDSDPTEANLESAEPELCIRLLQMPSVVNYSGLRKRLESSDGGWMVQFLE
Q
SGLDLLLEALARLSGRGVARISDALLQLTCISCVRAVMNSQQGIEYILSNQGYVRQLSQ
ALDTSNVMVK
K
QVFELLAALCIYSPEGHALTLDALDHYK
MVCSQQYRFSVIMSELSDSDNVPYVVTLLSVINAIILGPED
L
RSRAQLRSEFI
GLQLLDILTRLRDLEDADLLIQLEAFEEAKAEDEEELQRISDGINMNSHQEVFASLFH
K
VSCSPASAQLLSVLQGLMHLEPAGRSGQLLWEALENLVNRAVLLASDAQACTLEEVVERLLSIKGRPRP
S
PLDKAHKSVQTNSVQNQGSSSQNTTTPTTKVEGQQPVVASPCQHVGSIQSSSVDIAPQPVALEQCITAL
P
LPTPPLSSSTPVLPPTPPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTIS
P
PPPPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPLPGMCPVPPPPPLPRAGQIPPPPPLPGFSV
P
SMMGGVEEIIVAQVDHSLGSAWVPSHRRVNPPTLRMKKLNWQKLPSNVAR
ERNSMWATLGSPCTAAVEP
D
FSSIEQLFSFPTAKPKEPSAAPARKEPKE
VTFLDSKKSLNLNIFLKQFKCSNEEVTSMIQAGDTSKFDV
E
VLKQLLKLLPEKHE
IENLRAFTEERAKLSNADQFYVLLLDIPCYPLRVECMMLCEGTAIVLDMVRPKAQ
L
VLTACE
SLLTSQRLPVFCQLILKIGNFLNYGSHTGDADGFKISTLLKLTETKSQQSRVTLLHHVLEEVE
K
SHPDLLQLSRDLEPPSQAA
GINVEIIHSEASANLKKLLEAERKVSASIPEVQKQYAERLQASIEASQEL
D
KVFDAIEQKKLELADYLCEDPQQLSLEDTFSTMKTFRDLFTRALK
ENKDRKEQMAKAERRKQQLAEEEA
R
RPRDEDGKP
IRKGPGKQEEVCVIDALLADIRKGFQLRKTARGRGDTEASGRVAPADPPKATEPATASNP
T
QGTNHPASEPLDTTAADEPQGWDLVDAVTPSPQPSKEEDGPPALERRSSWYVDAIDFLDPEDTPDAQPS
E
GVWPVTLGDGQALNPLEFSSNKPPGVKSSHQDATDPEALWGVHRTEADSTSEGPEDEAQRGQSTHLPRT
G
PGEDEDGEDTAPESALDTSLDRSFSEDAVTDSSGSGTLPRVQGRVSKGTSKRRKKRPSRNQE
EFVPDSD
D
IKAKRLCVIQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser