NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36481.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36481.1 Public Mus musculus 12 Zfyve26 21 106 86 CCDS HistoryNCBI Gene:211978Re-query CCDS DB by CCDS ID:36481.1Re-query CCDS DB by GeneID:211978See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 36481.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000021547 ENSMUSP00000021547 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021547Link to Ensembl Protein Viewer:ENSMUSP00000021547Re-query CCDS DB by Nucleotide ID:ENSMUST00000021547Re-query CCDS DB by Protein ID:ENSMUSP00000021547
Original member Current member NCBI NM_001008550.1 NP_001008550.1 Accepted alive Link to Nucleotide Sequence:NM_001008550.1Link to Protein Sequence:NP_001008550.1Re-query CCDS DB by Nucleotide ID:NM_001008550Re-query CCDS DB by Protein ID:NP_001008550Link to BLAST:NP_001008550.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001008550.1 2529 Q5DU37-1 2529 100% 0 0

Chromosomal Locations for CCDS 36481.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 79233966 79234169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79236614 79236658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79237173 79237355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79238322 79238381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79238904 79239045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79239857 79240056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79240896 79241093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79244272 79244490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79246035 79246244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79246471 79246618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79249463 79249683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79251154 79251290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79252149 79252180 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79255230 79255366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79257415 79257578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79260801 79260899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79261578 79261824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79263773 79263949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79264311 79264433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79265688 79265792 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79266358 79266554 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79268359 79269101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79270838 79270940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79272067 79272285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79273293 79273457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79273557 79273676 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79274852 79275115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79276243 79276444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79278408 79278559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79279090 79279158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79280043 79280129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79280357 79280965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79282802 79283002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79284036 79284199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79285259 79285347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79285482 79285646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79286206 79286327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79287375 79287879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79290874 79290963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79293826 79293904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 79295477 79295670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7590 nt):
ATGAGTTACCCATTTGGGAAAGAGGAAACCGCTACAGAGGAGGAACTTTTTGAGTTTTTCTGTGAGTGCC
TG
CGGAGGGGAGACTGGGAGTTGGCACAAGCATGTGTACCTCAACTACACCGGGGACAAGGAGAGATCCC
C
CAAAAGGTGGAGGACATACTACAGGCGCTGGTGCAGTGTCCCATTCTGCTAAGATGTGGGCCAGACATC
AAC
CCTCAGAGATTAGCCTGGCTCTGGCTTCTTGTATTAGAAAAATGGCTGGCCCCAGAAAAGAAATTAC
TT
TCTACAGCTATCCGGAGAAAACTGGAGTTTCTTTTTTTGTCAGAAGACCTCCAAGGTGACATTCCAGA
G
ACCATCCTTAAGGAGCTATTTGAAACACTAGCACAAGGCCCAGCGGGCAGTATACCTGACAGAAGGACC
CCT
CAGCTCAGCCCCGAAGCTGTCTCCGTGCTCTGGAATCTTCTGAAGCAGGCCCCACGGCCAGCCCAGG
CC
CTCTTGGAGCTGCTGCTCGAGGACCACCACAGTGCCAGCCTGTGCCCTAGTCCTCTGCAGAAATCCCT
G
CTGGACCTCATCCGAGAGGCATTGCAGACCCTGCGGGACCCTGCCTCTCAGCCCCCCGGGGTGGCCGAT
GCT
GTCTGTGGAGCCCTTCAGGCTCTATGCTGCAAAGCTGAGCTACCAGAGAGTGAGTGGCGTGTCCTGT
GT
GAGGAACTGTTGGAGACCTGCAGGACTGAGGACAGTCCCCTGCAGGAGGAACGGCTCCTTGGTTGCCT
G
TTGCACAAGGCTGGACGGAACCTACTGTCCCTCTATGGCCACACCTATGCAGAGAAGGTGGCAGAAAGA
CCA
CCAAAGGCCACACTTTCAGGAAAAGATCATCCTGATCCCGAGCGGGCGATGCTGGCCCTGTTCTCCA
CT
CCTGACCCAGCCCACGCGTGGAAAATGGCCTTTTTCTACTGCCTGAGTAACAACAAACACTTCCTGGA
G
CAGATCCTTGTGACAGCACTGACCCTGTTGAAAGAGGAAGATTTCCCAAGCCTTGGATACCTGCTTGAT
AGA
GAATTCAGGCCTCTCAGTCACCTGCTCGTGCTCCTGGGCTGGACACACTGCCAGAGCCTTGAATCAG
CT
AAGAGACTGCTCCAGACTCTCTACAGGACCCAGGACCAAGGCCATGATGAGCTTCTCAGGGATGCCTG
T
GAAGGGTTGTGGGCTCACTTGGAAGTCTTGGAGTGGTGCGTACAACAGAGCAGCAACCTCATACCAAAG
AGA
GAGCTCTTGTGTCACTTACATGGTGGAGACAGCCACTCAGTGCTCTACTCTCTCCATCATCTTACAA
AC
CTTCCAGCCCTCAACGAGGAAGAAGTCCTCAAGCTGTTACAGAAGGAACCAACCAAGGACCTCCAGGG
A
GAGCATGAGACCCATGATGCCTCAGTCCCCGAGCACCTGAGCCAGTGTCAGAGCCTGACCCTCTACCAG
GGC
TTCTGTGCCATGAAGTATGCAGTCTATGCCCTCTGTGTGAACTCACACCAGCACTCTCAGTGCCAGG
AC
TGCAGAGACAGCGCCTCCGAGGACCTGGCCTTGGTGGAGCCAGGCAGCGATTCTCTCCCCTCCCCAGG
T
GCTTCACATCTCTTCCCTACGTACCTGGCCAGGTGCCGACAGTATTTACACAGCATCCCCGCCTCTCTG
TGC
CTGGAAATCCTGGAAAACATCTTCTCACTGCTCCTCATTACCTCTGCTGACCTTCACCCAGAGCCTC
AC
CTTCCCGAGGACTATGCCGAGGACGAGGACATTGAGGGGAAAGGCCCCTTGGGTTTGAGGTCCCCATC
A
GAGAGCCCTCAGCACATAGCCGCAACTGAGAGGAGGTCAGAGCGGGCTTCCATGGGACCCAGGAACCCT
GCT
CATACAGTGCCCGGCTGTCCAAAGGCAGAGCCGAAAGACAGTTCACCAGGGCCTCACAAGCACAGCT
TT
TTGGATCTGAAGCACTTTACTAGTGGCGTGAATGGATTCCTGGCCGATGAGTTTGCAATGGGAGCGTT
C
CTCAGCCTTCTTCAGGAGCAGCTCACTGAAATCAGCAGCCACCGCACTCCCGAGGAGACAAAGCTGCCG
GAA
GACCAGAGCTGTTCAGCGGCCAGAGATGGACTGCAGAGCCGCCTGCACAGGTTCTCAAAGGTTCTCT
CC
GAGGCACAGTGGCGGTACAAAGTGGTAACGAGCAACCAGGGCTCAGAAGAGCAACCTTCCCGAAGATA
C
CGGCCCATTGCCACGAGGCATTCTAGTCTCCGCCGAGGTCGTCGGACCAGAAGGACCCGGGCAGATGGC
CGG
GAAAGAGGCTCCAACCCATCCCTGGAAGGGACAAGTAGTGAGCTGAGCACAAGTACTTCAGAAGGGA
GT
CTGAGTGCTGTGTCTGGGCAGGTGGAGTCAGACAGCCGGTTTCAGACCCAACCTCAGAGTTCGATCAT
C
CCCATGATGTTCTCCACGCCGGAGTCTCTGCTGGCATCCTGCATCCTCAGGGGGAACTTTGCAGAAGCC
CAT
CAGGTGGTACTCATGTTCAACCTGAAGTCCTCACCTATCGCCGGGGAGCTGATGTTCGTAGAGCGAT
AC
CAAGAGGTAATCCAGGAGCTGGCCCGCGTAGAACATAAGATTGAAAACCAGAATTCAGATGGGGGTAA
C
AACACCATCCGGCGCACTGGCAGTGGGCGCTCAACTCTCCAGGCCATCGGCAGTGCCGCGGCAGCAGGG
ATG
GTATTTTACTCCATCTCTGATGTGACTGAGAAGCTCCTTAGCCCCTCTGAAGACCCCATCCCCACGC
TC
CAGGAGGATTTTTGGATAAATGCTACTCCCATGGAGACCACCACGCCTCTTAGAGAAGTCCTAGAAGA
C
CTCAGTCCTCCTGCCATGGCTGCATTCGACCTAGCTTGCTGCCAGTGCCAGCTCTGGAAGACCTGCAAA
CAG
CTCTTAGAAACAGCCGAGCGGCGACTGAGCAGCAGCCTTGAGAGTCGGGGTCGAAGGCTCGACCAGG
TT
GTCCTGAATCCTGATGGTATGCGAGGTTTTCCATTTGTCCTTCAGCAAATTAGTAAAATTCTCAGTTA
C
CCACTTATGCAAACAGGACTTGCAAAATCAGAGACTCTAGAAGAAAGGGGAGGAGGCGCTCCGAGGAGC
AGC
ATCTCTGAGCTGCTTCAGATGTGCTGGCCCAGCCTCACCGAAGACTGCGTTGCCAGCCACACCAGCC
TT
TCCCAGCAGCTGGAGCAGGCTCTGCAGTCACTGCGAGAGGCATTAGCGTTGCCAGAGTCCAAGAGTAC
T
CCACTCTCTTGCCTAGTGGAGCAGGCAGCCCAGAAAGCCCCCGAGGCAGAGGCCCACCCCGTGCACATC
CAA
AGTCAGCTCCTCCAAAAGACCCTGGGAAGACAGACCCCGGCAGGCCACAGACAGACTGACTATGTGG
GA
GCCTTCTTCAGCTACTGTAGCAGCCTGGCTGCCGTCCTCCTCCGGAGTCTGAGCTCCGACCCTGATCA
T
GTGGAGGTCAGGGTTGGAAATCCCTTTGTTCTCCTGCAGCAGAGCTCTTCCCAACTGGTGTCACATCTC
CTG
CTTGAAAGACAAGTTCCCCCAGACAGGTTGGCAGCCCTCCTTGCCCAAGAGCATCTCAACCTAAGTG
TG
CCACAGGTCATTGTCAGCTGCTGCTGTGAGCCCCTTACTCTTTGCCTGTCCCGACAAAGCCAGCAGGC
C
TCATCCCTCCTGACCCACCTAGGCATGCTGGCTCGAGAGCACGCCTCTCACCTTCTGGATGGCCTGCCT
CTC
TCTACGCTGGGCTCCCCTAGACCAAGCGAGAATCCCTCAGCAGAGAGAAAGTCTCATTCCTCCCCAA
AG
GATTCACTCCCGGCCTTCACCGCCTCTGCCTTGGCCTTCCTTAAGTCTCGCTCAAAGATACTGGCCAT
G
GTGGCCTGCCTACGGACTTCCCGAGGGACAAAGGTCAGCAAGCCCGGCCTGTCTTGGAAGGAACTGCGT
GGT
CGCAGGGAGGCACCTCTGACTGCAGAGAAGGTAGCCCAGGAGTGTGAGCACCTCCTGGAACAGTTTC
CT
GTGTTTGAGGCTGCCCTCCTGGCTAATTGGGAGCCTCTACAGCAAGCCTCTGAGCCAAAACAGAGTCT
G
GCAGCCAGTCTCTGTGGACAGGCTAATCTCTCTACTGTGCTTCTGGGCCTACATTCTTCACTGGCCCTG
GAC
ATACTAACTGAGGCCTTTGAGGGAGCTTTGGTGGCCAGAGATTGGCCACGGGCCCTTCAACTCATTG
AC
GTGTATGGGCAAGACTTGGATGACCTGAGCATTGTACAGGATTCGGTCCTGACCTGTGCTGCTGTGTG
T
GACAAGGAAGGTTGGCAGTACCTGTTTCCTGTGAAGGATGCATCCCTGAGAAGTCAGCTGGCCCTTCGG
TTT
GTGGACAAGTGGCCCCTGGAGTCCTGCCTGGAGATCCTGGCCTACTGTGTTTCAGACATGGCTGTCC
AA
GAAGAACTGAAATCTGAGCTGCAGAGGAAGCTAATGGAGCTGCGGGTCTATCAGAAGATCCTAGGTTT
A
CAGGATCCCCCAGTGTGGTGTGACTGGCAGACCCTGAGGAGCTGCTGTGCTGAAGACCCATCAGCGGTC
ATG
GACATGATGCTGGACTCACAGGAGTATGAACTATGTGAGGAGTGGGGGCGTCTGTACCCCATTCCAA
GA
GAGCACTTGGTCAGCCTGCATCACAAGCATCTTCTCCACCTGCTAGAAAGAAGCGAGCATGACAAGGC
T
CTTCAACTCCTGCAACGAATCCCTGATCCCACCATGTGCCTTGAAGTCACAGAGAGGTCCCTCGACCAG
CAC
CCTAGCTTAGCCACGTCACACTTCTTGGCCAACTACCTCACCTCCCACTTCTATGGAGAGCTGACCA
CT
GACCGACACCGTGAGATCCAGGCACTGTACATGGGATCTAAGGTTCTTCTGACCCTGCCTGAACAGCA
C
CGGGCCAGCTATGCCCGTTTGTCCTCCAGCCCTCTGCTCATGTTAGAGCAACTGCTGATGAACATGAAG
GTG
GATTGGGCCACCACGGCTGTGCAAACTCTGCACCAGCTGCTGGCTGGGCAAGACATCGGCTTCACCC
TC
GACGAAGTTGACTCGTTGCTTTCCAGATACGCAGGGAAAGCCCTGGACCTCCCATACCCTCTGAGAGA
G
AAACGATCAGATTCCATGATTCACCTCCAGGAGCCTGTCCACCAAGCTTCAGACTCAGAGACCCTGTCT
AGG
TCATCGTCAGCTGAGTTCTCCGCGGCTGCTGCTCCTGGAAGTGCCTTAGTCCGTTCCCCCAGTCCCA
AG
GAGAGAGCGTTCCCTCAGACTCAGCCGCCAGTGGAGTTCGTGCCCCCAGAAACACCCCCTGCCAGGGA
T
CAGTGGGTCCCAGATGAGACTGAGAGTGTCTGCATGGTCTGCTGCAGAGAGCACTTCACTATGTTCAAT
AGG
CGTCATCACTGTCGCCGCTGTGGGCGCCTAGTGTGCGGTTCCTGCTCCACTAAGAAAATGGTGGTGG
AA
GGCTTCAGAGAAAACCCCACCCGCGTCTGTGACCAGTGCTACAGTTACTACAACAAAGATACACCAGA
G
GAGAGCCCATGCCAGTCAGAAGTTCCAGACAGCGCTAAAAATGAAAGCCCTCCATATTCAGCTGTGGTG
AGA
GTCCCCAAAGCCACCGAGGTGGAATGGATCTTGAGTCTAAGTGAGGAAGAAAATGAACTGGTGCGCA
GT
GAATTTTACTATGAGCAGGCCCCCAGCGCTTCCCTGTGCATTGCCATCCTGAACCTCCACCGAGACAG
C
ATCGCCTGTGGTCACCAGCTGATTGAGCACTGCTGCAGGCTGTCCAGGGGCCTCACCAACCCAGAGGTG
GAC
GCCGGGCTGCTTATAGACATCATGAAGCAGCTACTCTTCAGTGCCAAGATGATGTTCGTCAAGGCTG
GC
CAGAGCCAGGACTTGGCTCTTTGTGACAGCTACATCAGCAAGGTAGATGTCCTGCATCTTTTAGTCGC
T
GCTGCCTACCGCCATGTACCATCTTTAGATCAGATCCTGCAGCCAGCCGCAGTAACCAGGCTGAGGAAC
CAG
CTCCTGGAAGCTGAGTACTACCAACTGGGCGTTGAGGTCTCTACAAAGACAGGGCTTGATTCCACAG
GA
GCATGGCATGCCTGGGGCATGGCCTGCCTCAAAGCTGGGAACCTCACTGTTGCAAGGGAGAAGTTCAC
T
CGCTGCCTGAAGCCTCCTTTGGACCTGAACCAATTGAGTCATGGCTCCAGGCTCGTCCAGGACGTGGTC
GAG
TACCTGGAGTCCACAGTGAGACCCCTCGTTTCCTTGCAAGATGATGACTACTTTGCCACCTTGAGGG
AA
CTGGAAGCCACCCTGCGAACCCAGAGCCTCTTGCTGGAGGCCATTCCGGAGGGGAAGATCATGAACAA
C
ACCTACTACCAAGAATGTCTCTTCTACCTGCACAACTACAGCACCAACCTGGCCATCATCAGCTTCTAC
ATG
AGGCATAACTGCCTCCGGGAAGCCCTGCTGCACCTGCTCAACAAGGAAAGTCCTCCAGAAGTCTTCA
TA
GAAGGCATTTTCCAGCCGAGCTATAAAAGCGGGAAGCTACACACTTTGGAGAACTTGCTGGAATCCAT
C
GATCCGACCTTGGAGAGCTGGGGAGCCCACCTGATCGCCGCCTGCCAACATCTGCAGAAGAACAGCTAC
TAC
CACATCCTGTACGAGCTGCAGCAGTTTATGAAGGATCAAGTCCGGGCTGCCATGACCTGTATTCGGT
TC
TTCAGTCACAAAGCAAAGTCATACACAGAGCTGGGAGAGAAGCTGTCATGGTTGCTTAAGGCCAAGGA
C
CACCTGAAGATCTACCTCCAAGAAACGTCCCGCAGCTCCGGAAGGAAGAAAGCCACCTTCTTCCGGAAG
AAG
ATGACTGCGGCTGATGTGTCCAGGCACATGAATACGCTGCAGCTGCAGATGGAAGTGACCAGATTCT
TA
CATCGCTGTGAAAGCGCTGGGACCTCTCAGGTCACCACCCTGCCCCTGCCAACACTCTTTGGAAACAA
C
CACATGAAAATGGAAGTTGCCTGCAAGGTTATGCTGGGAGGGAAAAATGTGGAAGATGGTTTTGGAATT
GCA
TTCCGTGTTCTGCAGGACTTCCAGCTGGACGCTGCTGCGACCTACTGCAGAGCTGCCAGGCAGTTGG
TT
GAGAGGGAAAAATATGGTGAGATCAGACAGCTGCTCAAGTGTGTTAGTGAGTCAGGCATGGCAGCCAA
A
AGCGACGGTGACACCATCCTCCTCAACTGCCTGGAAGCCTTCAAGAGAATCCCGCCTCAGGAGCTGGAG
GGA
CTGATCCAGGCCATCCACAGCGATGACAACAAGGTTCGGGCCTATCTGACATGTTGCAAGCTACGTT
CT
GCCTACCTGATTGCTGTGAAGCAAGAACACTCGCAGGCCGCCGCCCTCGTCCAGCAGGTGCAGCAGGC
T
GCCAAAAGCAGTGGGGATTCTGTAGTGCAGGACATCTGTGCTCAGTGGCTTCTGACAAGCCACTCTCGA
GGT
GCCCATGGCTCAGGCTCCAGGAAGTGA


Translation (2529 aa):
MSYPFGKEETATEEELFEFFCECLRRGDWELAQACVPQLHRGQGEIPQKVEDILQALVQCPILLRCGPDI
N
PQRLAWLWLLVLEKWLAPEK
KLLSTAIRRKLEFLFLSEDLQGDIPETILKELFETLAQGPAGSIPDRRT
P
QLSPEAVSVLWNLLKQAPRPAQALLELLLEDHHSASLCPSPLQKSLLDLIREALQTLRDPASQPPGVAD
A
VCGALQALCCKAELPESEWRVLCEELLETCRTEDSPLQEERLLGCLLHKAGRNLLSLYGHTYAEKVAER
P
PKATLSGK
DHPDPERAMLALFSTPDPAHAWKMAFFYCLSNNKHFLEQILVTALTLLKEEDFPSLGYLLD
R
EFRPLSHLLVLLGWTHCQSLESAKRLLQTLYRTQ
DQGHDELLRDACEGLWAHLEVLEWCVQQSSNLIPK
R
ELLCHLHGGDSHSVLYSLHHLTNLPALNEEEVLKLLQKEPTKDLQGEH
ETHDASVPEHLSQCQSLTLYQ
G
FCAMKYAVYALCVNSHQHSQCQDCRDSASEDLALVEPGSDSLPSP
GASHLFPTYLARCRQYLHSIPASL
C
LEILENIFSLLLITSADLHPEPHLPEDYAEDEDIEGKGPLGLRSPSESPQHIAATERRSERASMGPRNP
A
HTVPGCPKAEPKDSSPGPHKHSFLDLKHFTSGVNGFLADEFAMGAFLSLLQEQLTEISSHRTPEETKLP
E
DQSCSAARDGLQSRLHRFSKVLSEAQWRYKVVTSNQGS
EEQPSRRYRPIATRHSSLRRGRRTRRTRADG
R
ERGSNPSLEGTSSELSTSTS
EGSLSAVSGQVESDSRFQTQPQSSIIPMMFSTPESLLASCILRGNFAEA
H
Q
VVLMFNLKSSPIAGELMFVERYQEVIQELARVEHKIENQNSDGGNNTIRRTGSGRSTLQAIGSAAAAG
M
VFYSISDVTEKLLSPSEDPIPTLQEDFWINATPMETTTPLREVLEDLSPPAMAAFDLACCQCQLWKTCK
Q
LLETAERRLSSSLESR
GRRLDQVVLNPDGMRGFPFVLQQISKILSYPLMQTGLAKSETLEERGGGAPRS
S
ISELLQMCWPSLTEDCVASHTSLSQQLEQALQSLREALALP
ESKSTPLSCLVEQAAQKAPEAEAHPVHI
Q
SQLLQKTLGRQTPAGHRQTDYVGAFFSYCSSLAAVLLRSLSSDP
DHVEVRVGNPFVLLQQSSSQLVSHL
L
LERQVPPD
RLAALLAQEHLNLSVPQVIVSCCCEPLTLCLSRQSQQASSLLTHLGMLAREHASHLLDGLP
L
STLGSPRPSENPSAERKSHSSPKDSLPAFTASALAFLKSRSKILAMVACLRTSRGTKVSKPGLSWKELR
G
RREAPLTAEKVAQECEHLLEQFPVFEAALLANWEPLQQASEPKQSLAASLCGQANLSTVLLGLHSSLAL
D
ILTEAFEGALVARDWPRALQLIDVYGQDLDDLSIVQDSVLTCAAVC
DKEGWQYLFPVKDASLRSQLALR
F
VDKWPLESCLEILAYCVSDMAVQEELKSELQRKLMELRVYQK
ILGLQDPPVWCDWQTLRSCCAEDPSAV
M
DMMLDSQ
EYELCEEWGRLYPIPREHLVSLHHKHLLHLLERSEHDKALQLLQRIPDPTMCLEVTERSLDQ
H
PSLATSHFLANYLTSHFYGELTTDRHREIQALYMGSK
VLLTLPEQHRASYARLSSSPLLMLEQLLMNMK
V
DWATTAVQTLHQLLAGQDIGFTLDEVDSLLSRYAGKALDLPYPLREKRS
DSMIHLQEPVHQASDSETLS
R
SSSAEFSAAAAP
GSALVRSPSPKERAFPQTQPPVEFVPPETPPARDQWVPDETESVCMVCCREHFTMFN
R
RHHCRRCGRLVCGSCSTKKMVVEGFRENPTRVCDQCYSYYNK
DTPEESPCQSEVPDSAKNESPPYSAVV
R
VPKATEVEWILSLSEEENELVRSEFYYEQ
APSASLCIAILNLHRDSIACGHQLIEHCCRLSRGLTNPEV
D
AGLLIDIMKQLLFSAKMMFVKAGQSQDLALCD
SYISKVDVLHLLVAAAYRHVPSLDQILQPAAVTRLRN
Q
LLEAEYYQLGVE
VSTKTGLDSTGAWHAWGMACLKAGNLTVAREKFTRCLKPPLDLNQLSHGSRLVQDVV
E
YLESTVRPLVSL
QDDDYFATLRELEATLRTQSLLLEAIPEGKIMNNTYYQECLFYLHNYSTNLAIISFY
M
RHNCLREALLHLLNK
ESPPEVFIEGIFQPSYKSGKLHTLENLLESIDPTLESWGAHLIAACQHLQKNSY
Y
HILYELQQFMK
DQVRAAMTCIRFFSHKAKSYTELGEKLSWLLKAKDHLKIYLQETSRSSGRKKATFFRK
K
MTAADVS
RHMNTLQLQMEVTRFLHRCESAGTSQVTTLPLPTLFGNNHMKMEVACKVMLGGKNVEDGFGI
A
FRVLQ
DFQLDAAATYCRAARQLVEREKYGEIRQLLKCVSESGMAAKSDGDTILLNCLEAFKRIPPQELE
G
LIQAIHSDDNK
VRAYLTCCKLRSAYLIAVKQEHSQAAALVQQVQQAAKSSGDSVVQDICAQWLLTSHSR
G
AHGSGSRK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser