NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36408.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36408.1 Public Mus musculus 12 Greb1 21 106 86 CCDS HistoryNCBI Gene:268527Re-query CCDS DB by CCDS ID:36408.1Re-query CCDS DB by GeneID:268527See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36408.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000048064 ENSMUSP00000044454 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000048064Link to Ensembl Protein Viewer:ENSMUSP00000044454Re-query CCDS DB by Nucleotide ID:ENSMUST00000048064Re-query CCDS DB by Protein ID:ENSMUSP00000044454
Original member Current member EBI,WTSI ENSMUST00000162112 ENSMUSP00000124348 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000162112Link to Ensembl Protein Viewer:ENSMUSP00000124348Re-query CCDS DB by Nucleotide ID:ENSMUST00000162112Re-query CCDS DB by Protein ID:ENSMUSP00000124348
Original member Current member EBI,WTSI OTTMUST00000082200 OTTMUSP00000044039 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000082200Link to Vega Protein Viewer:OTTMUSP00000044039Re-query CCDS DB by Nucleotide ID:OTTMUST00000082200Re-query CCDS DB by Protein ID:OTTMUSP00000044039
Original member Current member NCBI NM_015764.4 NP_056579.2 Accepted alive Link to Nucleotide Sequence:NM_015764.4Link to Protein Sequence:NP_056579.2Re-query CCDS DB by Nucleotide ID:NM_015764Re-query CCDS DB by Protein ID:NP_056579Link to BLAST:NP_056579.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056579.2 1954 Q3UHK3 1954 100% 0 0

Chromosomal Locations for CCDS 36408.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 16672380 16672543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16673746 16673884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16674610 16674810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16677688 16677823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16680200 16680418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16681330 16681504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16682128 16682332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16684362 16684523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16688497 16688639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16690759 16690917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16692685 16692787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16696209 16696834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16698542 16698646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16699496 16699692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16701161 16701276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16702325 16702664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16704430 16704566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16706096 16706291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16707803 16707983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16708553 16708750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16709432 16709560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16710272 16710400 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16711673 16712023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16714777 16714962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16716628 16716771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16717176 16717289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16720847 16720975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16723291 16723434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16724758 16724940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16733278 16733454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16735146 16735265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 16739889 16740045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5865 nt):
ATGGGCAATTCCTATGCTGGCCAGCTAAAGAGCACACGGTTTGAAGAGGTCCTCCACAACTCCATCGAGG
CT
TCCTTACGCTCCAACACCCTGGTGCCCCGGCCCATTTTCTCGCAGCTGTATCTGGAGGCTGAGCAGCA
G
CTGTCATCGTTAGAAGGCGGCAGCCGAGCAGACAATGAGGAAGAAGAAGAAGATGGAGAAGGAGGGTTA
GAA
CCCAGCAGTCCCCCAAATGCCTACCAGCTGCCCCCTCCTCCTGAAGGCTGCTGCACCACGGATGGCT
TC
TGTCAGGCTGGGAAGGACCTACGTCTTGTCTCCATTTCCAGTGAGCCCATTGAAGTCCCTGCAGGCTT
C
CTCCTGGTGGGTGCTAAGTCTCCCAGCCTGCCGGACCACCTCCTGGTGTGTGCAGTGGACAAGAGGTTC
TTG
CCCGATGACAATGGCCACAATGCCCTGCTTGGTTTCTCTGGGAACTGTGTTGGCTGTGGAAAGAAAG
GC
TTCTGCTATTTCACCGAGTTCTCCAACCACATCAACCTGAAGCTGACCACCCAGCCCAAGAAACAGAA
G
CACCTCAAGTACTATCTGGTTCGGAATGCACAAGGGGCACTGACCAAAGGACCTTTGATTTGCTGGAAA
GGC
TCCGAGTTCAGAGGTCGGCAGAACTCCACCAACACCTGCTCCAGTTCTCTCTTCCCACCGCTGGAGA
GC
TCGGGGTCCCTGGCTGCCTTCCCCACTGAGCCTGTTCCTGGGACAAACCCCAGTGTCCCAGTGGGAGC
T
CAACAGGCAGGACCAGCCTCTGATCACCCCTCAGTGACCACAGCAACAGGTCCTGCAGTCTTCAATGGC
AAG
GATTCCCCCAAGCACCCACAGCTGGTGAAGAGTAGCCTGTCTGCCCTGCCGCGCCCCTCAGCCTTGG
GT
ATCTTGCCAAACTCTGGGCCTCCCAAAAAACGGCACAAAGGGTGGTCCCCGGAGTCTAAATCAACCAC
G
GATGGTGGCTTCATTCAGGGTGGTGGCAACAGAGCCAAGCACGAAGGTACCAGCATACCTTGTGTGCCC
CAG
GCTGGCTTGGTGGGACCAGCTTCAGTCACCTTCCCGGTGGTGGCCTCTGGTGAACCAGTGTCTGTTC
CG
GACAACTTGCTGAAAATATGCAAGGCCAAGCCAGTGATATTTAAAGGCCATGGGAACTTTCCCTACCT
C
TGCGGAAACCTGAATGATGTGGTCGTCAGCCCCCTGCTGTACACCTGCTACCAGAACTCCCAGTCGCTT
GCC
AGGGCCTATGAGCAACACGGTGCCTCCACCATGCAGCCCATATCTGAGGAGACACAGCTGTTGCTGA
CC
GTCTACTACCTCGTCCAACTCGCTGCAGACCAGGTGCCGCTGATGGAGGACCTGGAGCAGATCTTCCT
A
CGCTCCTGGCGAGAGTCACACCTGACAGAGATAAGGCAGTACCAGCAGGCGCCTCCACAGCCCTTCCCG
CCA
GCCACCAGCACAGCAGCACCTGTGACTTCTGCACAGCTGCCCTGGCTGGCCGGCCTGGCCGCCAGCT
CC
TGTAATGACAGTGTGCATGTTATTGAGTGTGCTTACTCCCTGGCCGAGGGCCTCTCTGAGATGTTCCG
G
TTGCTCATCGAGGGGAAACTCTCCAAGACCAACTATGTGGTCATTATCTGTGCCTGCCGGAATGCCGCC
ATT
GACTCCTGTATTGCTGTCACAGGGAAATACCAAGCCCGCATTCTCTCTGAGAGCCTTCTCAGTCCTG
CT
GAGTACCAGAGAGAAGTTCACTACGAGCTGGTCACTGGCAAAGTGGACTCGCTGGGGACATTTTTTAG
C
AGCCTCTGTCCAGAGGGTGACATTGACATTTTGCTGGACAAATTTCACCAGGAAAATCAAGGCCATGTC
TCT
TCCTCATTCACTGCTTCCTCTACCAAGAAGACAGCTGTGCTGGATGCCAGTGGGGTCCCGGTGTGCA
CA
AGTTACCACCAGGAGCCACGGGGCGTCCGGCCCTTTCAGCTGGCGGTGGCACAGAAGCTCCTTTCCCA
C
GTGTGCTCCATCGCAGATTCCAGCACCCAGAATCTGGACCTGGGGTCCTTCGAGAAGGTGGACTTTCTC
ATT
TGCATTCCACCGTCAGAGGTGACCTACCAGCAGACCGTGTTCCACGTCTGGCATTCAGGGGTTCTGC
TG
GAGCTGGGCCTGGAGAAAGAGCCTGTGACCAAGCAGAGGGCGGAGCAACACGTTCTGAAACTAGACAC
G
GAGGCCCAGGCAAGATTTAAGGCCTTTCTGCAAAACTCCTTCCAGAACCCACATACGCTCTTTGTCCTC
ATC
CACGACCACGCCCACTGGGATCTAGTGAGCAGTGCTGTTCATAACATCTACTCTCAAAGTGACCCAT
CT
GTGGGGTTAGTGGACAGACTGCTCAACTGCAGGGAGGTGAAAGAGGCGCCCAACATTGTGACCCTCCA
T
GTGACCTCTTTCCCGTATGCGCTGCAGACTCAGCACACCCTCATTAGCCCATACAATGAGATCCATTGG
CCC
ATCTCCTTCAGTAATGGAGTGGACCTGTATCATGAGAGTAAGAAGTACTTCGGGCTGTCTGAGTTTA
TT
GACTCCACCCTGTCAGGACACAGTCTTCCTCTGCTCCGATATGACAGTTCCTTTGAGGCCATGGTCAC
T
GCATTGGGGAAAAGGTTCCCCCGCCTGCACAGCGCGGTCATCAGGACCTTTGTTCTTGTGCAGCACTAT
GCG
GCCGCCATGATGGCCGTGAGTGGCCTCCCGCAGATGAAGAACCATACATCAGTGGAGACCCTAGAGA
TC
ACCCAGAACCTCCTCAACTCCCCGAAGCAGTGCCCTTGTGGCCACGGGCTCATGGTCCTGCTGCGCGT
G
CCCTGTTCACCCCTGGCAGCCGTGGCCTATGAGCGACTGGCCCACGTGCGGGCTCGCTTGGCTCTGGAG
GAA
CACTTTGAGATCATCCTGGGCCACCCCAGCTCCGGTATCACTGTAGGCAAGCACTTTGTGAAGCAGC
TC
AAGATGTGGCAGAAAATTGAGGATGCAGAATGGAGGCCTCAGACGTACTTAGAGTTGGAGGGCCTGCC
C
TGCATCCTGATCTTCAGTGGGATGGACCCTCATGGGGAGTCACTGCCCCGGTCTCTGAGGTACTGTGAC
CTG
CGTCTAATAAACTCCTCCTGCCTGGTGAGGACAGCCCTGGAGCAGGAGCTGGGTCTGGCTGCCTACT
TT
GTTAGCAATGATATCCCCTTGGAGAAGGGGCCCAAGAACGAGGCCTTGGAGAGTGATGGGGAGAAACT
G
AGCAGCACCGATGAAGACGAGGAGGCGGGGACAGAAGGGTGTTTTGAAGCAGGCTCTACGTCAGAGCAG
AGG
GGCCCTGTGAAGAGGGAACGCTCCCACTCCCACGACTCTGCATCGTCATCCCTCTCCTCCAGAGCAT
CT
GGCTCGGTGCTCTATGGTGAGTCCCTGGCCCAGCCCTCAGGACCTCCTCAGGGAGAGCTTACCAGATC
A
CCTCCATCCTGTGGCCCTGCAGAGGAAGGCAGGGCCCCTGGGGAAATCCAGCGCCTCCGAGTGAGTCAG
GGG
TCTACAGTCATCAGTAGGCACAGCCCTGGCCTGGTCCCACAGCCTGATTCTAGCCTCAGGACTGGTC
GG
AGGAGCTTGCAGGTGCCAGCCGCCCCGTCCTCCCAGCTGTCCTCCTCCTCGGGCTCATCATCCACATG
T
GCGGTGCCCACTGCCAATGTGCTGGTCCTTCAAGCCTCTCAGTGCTCCATGGCCAAGGCCTGCCGGCAG
CCA
CCCATCGTCTTCCTGCCGAAGCTTGTGTACGACATGCTCCTGTCCACCGACAGCAGCGGCTTGCCCA
AG
TCTGCCTCCCTCCTGCCTTCCCCTTCAGTCATGTGGACCAGCTCCTTCCGCCCCCTGCTCAGCAAGAT
G
ATGACATCAACTGAGCAGTCTCTCTACTACCGGCAGTGGACAGTGCCCCGGCCCAGCCACATGGACTAC
GGC
AACAGAGCTGAGGGCCGTGTGGACAGCTTCCACCCCCGCAGGCTGCTGCTCAGTGGGCCACCTCAGA
TT
GGGAAGACAGGTGCCTACCTGCAGTTCCTCAGTATCTTGTCCAGGATGCTGATTCGGCTGACAGAAGT
G
GATGTTTACGACGAAGAAGAGATCAATACCAGCTTCCGAGAGGAATCGGAGTGGCGTTACCTCCAGCTG
GCC
GACCCCTGGCCAGACCTGGAGCTCTTCCAGAAGATGCCTTTTGATTACATCATTCATGACCCGAAGT
AT
GAGGACGCCAGTCTGATTTGTTCACACCCTCAGACCATCAAGAGTGAAGACAGAGGGATGTCCAGGAA
G
CCGGAGGACCTGTATGTGCGGCGTCAGACGGCACGTATGAGACTGTCCAAGTATGCAGCATACAACACG
TAC
CACCACTGTGAGCAGTGCCAGCAGTACATGGGCTTCCACCCCCACTACCAGCTCTCTGAGTCCACCC
TG
CACGTCTTTGCCTTCTCTTGCTCCATGCTAGGAGAGGAGGTCCAACTTCACTTCATCATCCCCAAGTC
C
AAGGAGCACCACTTTGTTTTCAGCCAACCCGGAGGCCAGCTGGAGAGCATGCGCTTGCCCCTCGTCACA
GAC
AAGAGTCATGAACACATCAAAAGCCCAACCTTCACACCGACAACGGGCCGGCACGAGCACGGGCTCT
TT
AATTTGTACCATGCGATGGATGGAGCCAACCACCTACACGTGCTGGTGGTCAAGGAGTACGAAATGGC
C
ATTTATAAGAAATACTGGCCCAACCACATCATGCTTGTCCTCCCAAGCATCTTTAACAGTGCTGGTGTC
G
GG
GCTGCCCACTTCCTGATCAAAGAGCTTTGTTACCACAACCTGGAGCTGGAGCGGAACCGGCAGGAGG
AG
CTGGGGGTCAAGCCTCAGGACGTCTGGCCCTTCATCGTCATTGCTGATGACTCCTGTGTGATGTGGAA
T
GTAGCAGATGTGGACTGTGCCGGAGAACGGAGCAGGGAGTTTTCCTGGTCGGAGAGGAATGTCTCTCTG
AAA
TACATCATGCTACACATTGAGGCGTCCCCTAACATCACACACTATGCCCTGCTCGGCATGCGGAAGT
GG
GCCAGCAAGACCCGGGGCCGAGAGGTACAGGAGCCTTTTTCACGATGTCATGTGCACGACTTCATCAT
C
CTCAACGTGGACTTGACCCAGAATGTACAGTACAACCAGAACCGGTTTACATGTGACGATGTAGACTTC
AAC
CTCCGTGTGCACAGTGCTGGCCTCCTGCTCTGCCGGTTCAATCGCTTCAGTGTCATGAAGAAGCAGA
TT
GCAGTGGGTGGGCACAGGTCTTTCCACATCACATCCAAGGTATCTGACAGCTCTGTGGCCATTGTGCC
G
TCCCAGTACATCTGTGCCCCCGACAGTAAGCATACGTTCCTGGCAGCTCCCGCCCAGCTCCTGCTGGAG
AAA
TTCCTCCAATACCATAGCCATCGCTTCTTCCCGCTGTCTCTGAAGAATCACAGCCACCCCGTGTTGT
CT
GTAGACTGCTACCTGAACCTGGGACCTCAGATTTCTGTTTGTTATGTGAGCTCCAGGCCCCACTCCTT
A
AACATCAGCTGCTCTGACATGGTGTTCAGCGGGCTCCTGCTGTACCTCTGTGACTCTTTTGTGGGGGCT
AGC
TTCTTGAAGAAGTTCCATTTTCTGAAAGGAGCCACCTTGTGTGTGATCTGCCAAGACCGGAACTCAC
TT
CGCCAGACGGTGGTCCGCCTGGAGCTAGAAGATGAGTGGCAGTTCCGGCTGCGGGATGAGTTCCAGAC
A
GCCAATGCCAAGGAAGACAGGCCGCTCTTTTTCCTCACCGCACGGCACATCTGA


Translation (1954 aa):
MGNSYAGQLKSTRFEEVLHNSIEASLRSNTLVPRPIFSQLYLEAEQQLSSLEGGSRADNEEEEEDGEGGL
E
PSSPPNAYQLPPPPEGCCTTD
GFCQAGKDLRLVSISSEPIEVPAGFLLVGAKSPSLPDHLLVCAVDKRF
L
PDDNGHNALL
GFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYLVRNAQGALTKGPLICWK
G
S
EFRGRQNSTNTCSSSLFPPLESSGSLAAFPTEPVPGTNPSVPVGAQQAGPASDHPSVTTATGPAVFNG
K
DSPKHPQLVKSSLSALPRPSAL
GILPNSGPPKKRHKGWSPESKSTTDGGFIQGGGNRAKHEGTSIPCVP
Q
AGLVGPASVTFPVVASGEPVSVPDNLLKICKAKPVIFK
GHGNFPYLCGNLNDVVVSPLLYTCYQNSQSL
A
RAYEQHGASTMQPISEETQLLLTVYYLVQL
AADQVPLMEDLEQIFLRSWRESHLTEIRQYQQAPPQPFP
P
ATSTAAPVTSAQLPWLAGLAASSCNDSVHVIECAYSLAEGLSEMFRLLIEGKLSKTNYVVIICACRNAA
I
DSCIAVT
GKYQARILSESLLSPAEYQREVHYELVTGKVDSLGTFFSSLCPEGDIDILLDKFHQENQGHV
S
SSFTASSTKKTAVLDASGVPVCT
SYHQEPRGVRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFL
I
CIPPSEVTYQQTVFHVWHS
GVLLELGLEKEPVTKQRAEQHVLKLDTEAQARFKAFLQNSFQNPHTLFVL
I
HDHAHWDLV
SSAVHNIYSQSDPSVGLVDRLLNCREVKEAPNIVTLHVTSFPYALQTQHTLISPYNEIHW
P
ISFSN
GVDLYHESKKYFGLSEFIDSTLSGHSLPLLRYDSSFEAMVTALGKRFPRLHSAVIRTFVLVQHY
A
AAMMAVSGLPQMKNHTSVETLEITQNLLNSPKQCPCGHGLMVLLRVPCSPLAAVAYERLAHVRARLALE
E
HFEIILGHPSSGITVGKHFVKQLK
MWQKIEDAEWRPQTYLELEGLPCILIFSGMDPHGESLPRSLRYCD
L
RLINSSCLVRTALEQELGLAAYFVSNDIPLEKGPKNEALESDGEKLSSTDEDEEAGTE
GCFEAGSTSEQ
R
GPVKRERSHSHDSASSSLSSRAS
GSVLYGESLAQPSGPPQGELTRSPPSCGPAEEGRAPGEIQRLRVSQ
G
STVISRHSPGLVPQPDSSLRTGRRSLQVPAAPSSQLSSSSGSSSTCAVPTANVLVLQASQCSMAKACRQ
P
PIVFLPKLVYDMLLSTDSSGLPKSASLLPSPSVMWTSSFRPLLSKMMTSTEQSLYYRQWTVPRPSHMDY
G
NRAEGRVDSFHPRRLLLSGPPQ
IGKTGAYLQFLSILSRMLIRLTEVDVYDEEEINTSFREESEWRYLQL
A
DPWPDLELFQKMPFDYIIHDPKYEDASLICSHPQTIKSE
DRGMSRKPEDLYVRRQTARMRLSKYAAYNT
Y
HHCEQCQQYMGFHPHYQ
LSESTLHVFAFSCSMLGEEVQLHFIIPKSKEHHFVFSQPGGQLESMRLPLVT
D
K
SHEHIKSPTFTPTTGRHEHGLFNLYHAMDGANHLHVLVVKEYEMAIYKKYWPNHIMLVLPSIFNSAGV
G
AAHFLIKELCYHNLELERNRQEELGVKPQDVWPFIVIADDSCVMWNVADVDCAGERSREFSWSERNVSL
K
YIMLHIEASPNITHYALLGMRKWASKTRGREVQEPFSRCHVHDFIILNVDLTQNVQYNQN
RFTCDDVDF
N
LRVHSAGLLLCRFNRFSVMKKQIAVGGHRSFHITSK
VSDSSVAIVPSQYICAPDSKHTFLAAPAQLLLE
K
FLQYHSHRFFPLSLKNHSHPVLSVDCYLNLGPQ
ISVCYVSSRPHSLNISCSDMVFSGLLLYLCDSFVGA
S
FLKKFHFLK
GATLCVICQDRNSLRQTVVRLELEDEWQFRLRDEFQTANAKEDRPLFFLTARHI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser