NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36376.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36376.1 Public Mus musculus 11 Itgb4 21 106 86 CCDS HistoryNCBI Gene:192897Re-query CCDS DB by CCDS ID:36376.1Re-query CCDS DB by GeneID:192897See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36376.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000021107 ENSMUSP00000021107 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021107Link to Ensembl Protein Viewer:ENSMUSP00000021107Re-query CCDS DB by Nucleotide ID:ENSMUST00000021107Re-query CCDS DB by Protein ID:ENSMUSP00000021107
Original member Current member EBI,WTSI ENSMUST00000169928 ENSMUSP00000127604 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169928Link to Ensembl Protein Viewer:ENSMUSP00000127604Re-query CCDS DB by Nucleotide ID:ENSMUST00000169928Re-query CCDS DB by Protein ID:ENSMUSP00000127604
Original member Current member EBI,WTSI OTTMUST00000007883 OTTMUSP00000003825 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000007883Link to Vega Protein Viewer:OTTMUSP00000003825Re-query CCDS DB by Nucleotide ID:OTTMUST00000007883Re-query CCDS DB by Protein ID:OTTMUSP00000003825
Original member Current member NCBI NM_001005608.2 NP_001005608.2 Accepted alive Link to Nucleotide Sequence:NM_001005608.2Link to Protein Sequence:NP_001005608.2Re-query CCDS DB by Nucleotide ID:NM_001005608Re-query CCDS DB by Protein ID:NP_001005608Link to BLAST:NP_001005608.2

Chromosomal Locations for CCDS 36376.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 115977796 115977877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115979076 115979158 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115979361 115979462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115979614 115979818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115980675 115980771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115980941 115981112 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115982701 115982964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115983259 115983348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115983643 115983765 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115984037 115984201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115985022 115985098 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115986617 115986819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115988460 115988563 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115988657 115988755 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115988890 115989019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115989722 115989841 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115989938 115990044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115990675 115990708 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115990884 115991075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115991309 115991412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115991658 115991716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115991886 115991909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115993055 115993203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115993277 115993456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115994262 115994410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115997950 115998145 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 115999798 115999955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116000239 116000419 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116000543 116000680 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116003342 116003524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116003603 116003734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116005531 116005767 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116005897 116006055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116006461 116006610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116006986 116007174 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116007259 116007414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116007501 116007665 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116007755 116007865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 116007961 116008100 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5409 nt):
ATGGCAGGGCCCTGTTGCAGCCCATGGGTGAAGCTGCTGCTGCTGGCAGCAATGCTGAGTGCCAGCCTCC
CT
GGAGACCTGGCCAACCGCTGCAAGAAGGCTCAGGTGAAGAGCTGTACCGAGTGCATCCGGGTGGACAA
G
AGCTGTGCCTACTGCACAGACGAGCTGTTCAAGGAGAGGCGCTGCAACACCCAGGCGGAGCTTCTGGCT
GCA
GGCTGCAGGGGAGAGAGCATCCTGGTCATGGAGAGCAGCCTTGAAATCACAGAGAACACCCAGATCG
AC
ACCAGCCTGCACCGCAGCCAGGTATCTCCCCAAGGCCTGCAAGTCCGGCTGCGGCCGGGTGAGGAGCG
C
AGCTTTGTGTTCCAGGTGTTTGAGCCCCTGGAGAGCCCCGTGGATCTGTATATCCTCATGGACTTCTCC
AAC
TCCATGTCTGACGATCTGGACAACCTCAAGCAGATGGGGCAGAACCTGGCCAAGATCCTGCGCCAGC
TC
ACCAGCGACTACACCATTGGATTTGGAAAGTTTGTGGACAAAGTCAGCGTCCCACAGACAGACATGAG
G
CCCGAGAAACTGAAGGAGCCCTGGCCCAACAGTGATCCCCCGTTCTCCTTCAAGAACGTTATCAGCTTA
ACG
GAGAATGTGGAAGAATTCTGGAACAAACTGCAAGGAGAACGCATCTCAGGCAACCTGGACGCTCCTG
AA
GGGGGCTTTGATGCCATCCTGCAGACAGCTGTGTGCACAAGGGACATTGGCTGGAGGGCTGACAGCAC
C
CACCTGCTGGTGTTCTCCACCGAGTCTGCCTTCCACTACGAGGCTGATGGTGCCAACGTGCTGGCCGGC
ATC
ATGAACCGCAATGATGAGAAATGCCACCTGGACGCCTCGGGCGCCTACACCCAATACAAGACACAGG
AC
TACCCATCAGTGCCCACGCTGGTTCGCCTGCTTGCCAAGCATAACATCATCCCCATCTTTGCTGTCAC
C
AACTACTCTTACAGCTACTATGAGAAGCTCCATAAGTATTTCCCCGTCTCCTCTCTGGGCGTCCTGCAG
GAG
GATTCATCCAACATCGTGGAGCTGCTGGAGGAGGCCTTCTATCGAATTCGCTCCAACCTGGACATCC
GG
GCTCTGGACAGCCCCAGAGGCCTGAGAACAGAGGTCACCTCCGATACTCTCCAGAAGACGGAGACTGG
G
TCCTTTCACATCAAGCGGGGGGAAGTGGGCACATACAATGTGCATCTCCGGGCAGTGGAGGACATAGAT
GGG
ACACATGTGTGCCAGCTGGCTAAAGAAGACCAAGGGGGCAACATCCACCTGAAACCCTCCTTCTCTG
AT
GGCCTCCGGATGGACGCGAGTGTGATCTGTGACGTGTGCCCCTGTGAGCTGCAAAAGGAAGTTCGATC
A
GCTCGCTGTCACTTCAGAGGAGACTTCATGTGTGGACACTGTGTGTGCAATGAGGGCTGGAGTGGCAAA
ACC
TGCAACTGCTCCACCGGCTCTCTGAGTGACACACAGCCCTGCCTGCGTGAGGGTGAGGACAAACCGT
GC
TCGGGCCACGGCGAGTGCCAGTGCGGACGCTGTGTGTGCTATGGTGAAGGCCGCTACGAGGGTCACTT
C
TGCGAGTATGACAACTTCCAGTGTCCCCGGACCTCTGGATTCCTGTGCAATGACCGGGGTCGCTGTTCT
ATG
GGAGAGTGTGTGTGTGAGCCTGGTTGGACAGGCCGCAGCTGTGACTGTCCCCTCAGCAATGCCACCT
GC
ATCGATAGCAACGGGGGCATCTGCAACGGCCGAGGCTACTGTGAGTGTGGCCGTTGTCACTGCAACCA
G
CAGTCGCTCTACACGGACACCACCTGTGAGATCAACTACTCTGCGATACGCCTGGGTCTCTGTGAGGAT
CTC
CGCTCCTGCGTACAGTGCCAGGCCTGGGGCACCGGGGAGAAGAAAGGGCGCGCGTGTGACGATTGCC
CC
TTTAAAGTCAAGATGGTAGACGAGCTTAAGAAAGAAGAGGTGGTGGAGTACTGCTCCTTCCGGGATGA
G
GATGACGACTGCACTTACAGCTACAACGTGGAGGGCGATGGCAGCCCTGGGCCCAACAGCACAGTCCTG
GTC
CACAAAAAGAAAGACTGCCCTCCCGGCTCCTTCTGGTGGCTCATCCCCCTGCTCATCTTCCTCCTGT
TG
CTCCTGGCGTTGCTTCTGCTGCTCTGCTGGAAATACTGTGCCTGCTGCAAAGCCTGCCTGGGGCTTCT
T
CCTTGCTGCAACCGAGGTCACATGGTGGGCTTTAAGGAAGATCACTATATGCTTCGGGAGAACCTGATG
GCC
TCTGACCACCTGGACACGCCCATGCTACGAAGCGGGAACCTCAAGGGACGAGACACAGTCCGCTGGA
AG
ATCACCAACAATGTGCAGCGCCCTGGCTTTGCCACCCATGCCGCCAGCACCAGCCCCACGGAGCTCGT
A
CCCTACGGGCTGTCCCTGCGCCTTGGCCGCCTCTGCACTGAGAACCTTATGAAGCCGGGCACCCGAGAG
TGT
GACCAGCTACGCCAGGAGGTGGAGGAAAATCTGAATGAGGTGTATAGACAGGTCAGCGGCGCACACA
AG
CTCCAGCAGACGAAGTTCCGACAGCAGCCCAACACCGGGAAAAAGCAAGACCACACCATTGTGGACAC
A
GTGTTGCTGGCGCCCCGCTCCGCCAAGCAGATGCTGCTGAAGCTGACAGAGAAGCAGGTGGAGCAGGGG
TCC
TTCCATGAACTGAAGGTGGCCCCTGGCTACTACACTGTCACGGCAGAGCAGGATGCCCGGGGCATGG
TG
GAGTTCCAGGAGGGCGTGGAGCTGGTGGATGTGCGAGTGCCCCTCTTCATCCGGCCTGAGGATGATGA
T
GAGAAGCAGCTGCTGGTGGAGGCCATTGATGTCCCTGTGGGCACTGCCACCCTTGGTCGCCGTCTGGTA
AAC
ATCACCATTATCAAGGAACAAGCTAGTGGGGTAGTGTCCTTCGAGCAGCCTGAATACTCGGTGAGTC
GT
GGAGACCAGGTGGCCCGCATCCCTGTCATCCGGCACATCCTGGACAATGGCAAGTCCCAGGTCTCCTA
T
AGCACACAGGATAATACAGCACACGGACACCGGGATTATGTCCCTGTGGAGGGAGAGCTGCTGTTCCAT
CCT
GGGGAGACCTGGAAGGAGTTGCAGGTGAAGCTACTGGAGCTGCAGGAGGTCGACTCCCTCCTGCGTG
GC
CGCCAGGTCCGCCGCTTCCAAGTCCAACTCAGCAACCCCAAGTTCGGAGCCCGCCTGGGCCAGCCCAG
C
ACAACCACCGTTATTCTCGATGAAACGGACAGGAGTCTCATAAATCAAACACTTTCATCGCCTCCGCCA
CCC
CATGGAGACCTGGGCGCCCCACAGAACCCCAATGCCAAGGCTGCCGGGTCCAGGAAGATCCATTTCA
AC
TGGCTGCCCCCTCCTGGCAAGCCAATGGGGTACAGGGTGAAGTACTGGATCCAGGGCGACTCTGAGTC
T
GAAGCCCACCTTCTAGACAGCAAGGTGCCCTCAGTGGAACTCACCAACCTGTATCCCTATTGCGACTAC
GAA
ATGAAGGTGTGTGCCTATGGGGCACAGGGTGAGGGGCCCTATAGCTCACTGGTGTCCTGCCGCACCC
AC
CAGGAAGTACCCAGCGAGCCAGGGAGGCTGGCTTTCAATGTAGTCTCTTCTACGGTGACGCAGCTGAG
C
TGGGCAGAGCCAGCTGAGACCAATGGCGAGATCACAGCCTACGAGGTCTGCTATGGACTGGTCAATGAG
GAC
AACCGACCCATTGGACCTATGAAGAAGGTGCTCGTGGACAACCCCAAGAACCGGATGCTGCTCATTG
AG
AATCTGCGAGAATCCCAGCCATACCGATACACGGTTAAGGCGCGCAATGGGGCAGGATGGGGACCCGA
G
AGAGAGGCTATCATCAACCTGGCTACACAGCCCAAGCGGCCCATGTCCATCCCTATCATCCCAGACATC
CCC
ATAGTGGACGCCCAGGGTGGAGAAGACTACGAAAACTTCCTTATGTACAGTGATGACGTCCTGCGGT
CC
CCAGCCAGCAGCCAGAGGCCCAGCGTTTCTGATGACACTGAGCACCTGGTGAATGGCCGGATGGACTT
T
GCCTATCCAGGCAGCGCCAACTCCCTGCACAGAATGACTGCAGCCAATGTGGCCTATGGCACGCATCTG
AGC
CCACACCTGTCCCACCGAGTGCTGAGCACGTCCTCCACCCTTACCCGGGACTACCACTCTCTGACAC
GC
ACAGAGCACTCCCACTCAGGCACACTTCCCAGGGACTACTCCACCCTCACTTCCCTTTCCTCCCAAGG
C
CTCCCTCCTATCTGGGAAGATGGGAGGAGCAGGCTTCCGCTGTCCTGGACTCTTGGGTCCTTGAGCCGG
GCT
CACATGAAGGGTGTGCCCGCATCCAGGGGTTCACCAGACTCTATAATCCTGGCCGGGCAGTCAGCAG
CA
CCCTCCTGGGGTACAGATTCCCGTGGGGCTGTGGGTGTGCCTGACACACCCACTCGGCTGGTGTTCTC
T
GCCCTGGGGCCCACGTCTTTGAAGGTGAGCTGGCAGGAGCCACAGTGTGATCGGATGCTGCTGGGCTAC
AGT
GTGGAATACCAGCTACTAAACGGCGGCGAGATGCATCGGCTCAACATCCCTAACCCTGGCCAAACCT
CG
GTGGTGGTAGAGGATCTCCTGCCTAACCACTCCTATGTGTTCCGGGTACGGGCCCAGAGCCAGGAGGG
C
TGGGGCCGAGAGCGAGAGGGTGTCATCACCATCGAGTCCCAGGTGCACCCGCAGAGCCCTCTCTGCCCC
CTG
CCAGGCTCAGCCTTCACTCTGAGCACCCCCAGCGCCCCGGGACCGCTGGTGTTCACTGCCCTAAGCC
CA
GACTCCCTGCAGCTCAGCTGGGAGCGGCCGAGGAGGCCCAATGGAGATATCCTTGGCTACCTGGTGAC
C
TGTGAGATGGCCCAAGGAGGAGCACCAGCCAGGACCTTCCGGGTGGACGGAGACAACCCTGAGAGCCGG
TTG
ACTGTACCTGGCCTCAGTGAGAACGTTCCTTACAAGTTCAAGGTTCAGGCCAGGACGACCGAGGGCT
TC
GGGCCAGAGCGTGAGGGTATCATCACCATCGAGTCTCAGGTTGGAGGCCCCTTCCCACAGCTGGGCAG
C
CATTCTGGGCTCTTCCAGAACCCAGTGCAAAGCGAGTTCAGCAGCGTGACCAGCACGCACAGCACCACG
ACT
GAGCCCTTCCTCATGGATGGTCTAACCCTGGGGACCCAGCGCCTGGAAGCAGGAGGCTCCCTCACCC
GG
CATGTGACCCAGGAATTCGTGACCCGGACCTTAACGGCCAGTGGCTCTCTCAGCACTCATATGGACCA
A
CAGTTCTTCCAAACCTGA


Translation (1802 aa):
MAGPCCSPWVKLLLLAAMLSASLPGDLANRCKKAQVKSCTECIRVDKSCAYCTDELFKERRCNTQAELLA
A
GCRGESILVMESSLEITE
NTQIDTSLHRSQVSPQGLQVRLRPGEERSFVFQVFEPLESPVDLYILMDFS
N
SMSDDLDNLKQMGQNL
AKILRQLTSDYTIGFGKFVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNVISL
T
ENVEEFWNKLQGERISGNLDAPEGGFDAILQTAVCT
RDIGWRADSTHLLVFSTESAFHYEADGANVLAG
I
MNRNDEKCHLDASGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYE
KLHKYFPVSSLGVLQ
E
DSSNIVELLEEAFY
RIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDID
G
THVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCEL
QKEVRSARCHFRGDFMCGHCVCNEGWSGK
T
CNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCN
DRGRCS
M
GECVCEPGWTGRSCDCPLSNATCIDSNG
GICNGRGYCECGRCHCNQQSLYTDTTCEINYSAIRLGLCED
L
RSCVQCQAWGTGEKKGRACDDCPFKVKMVDELKK
EEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVL
V
HKKK
DCPPGSFWWLIPLLIFLLLLLALLLLLCWKYCACCKACLGLLPCCNRGHMVGFKEDHYMLRENLM
A
SDHLDTPMLRSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTEL
VPYGLSLRLGRLCTENLMKPGTRE
C
DQLRQEVEEN
LNEVYRQVSGAHKLQQTKFRQQPNTGKKQDHTIVDTVLLAPRSAKQMLLKLTEKQVEQG
S
FHELKVAPGYYTVTAEQ
DARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPVGTATLGRRLV
N
ITIIKEQ
ASGVVSFEQPEYSVSRGDQVARIPVIRHILDNGKSQVSYSTQDNTAHGHRDYVPVEGELLFH
P
GETWKELQVKLLELQEVDSLLRGRQVRRFQVQLSNPKFGARLGQPSTTTVIL
DETDRSLINQTLSSPPP
P
HGDLGAPQNPNAKAAGSRKIHFNWLPPPGKPMGYR
VKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDY
E
MKVCAYGAQGEGPYSSLVSCRTHQE
VPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNE
D
N
RPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIPDI
P
IVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDT
EHLVNGRMDFAYPGSANSLHRMTAANVAYGTHL
S
PHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLPRDYSTLTSLSSQ
GLPPIWEDGRSRLPLSWTLGSLSR
A
HMKGVPASRGSPDSIILAGQSAAPSWGT
DSRGAVGVPDTPTRLVFSALGPTSLKVSWQEPQCDRMLLGY
S
VEYQLLNG
GEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCP
L
P
GSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGAPARTFRVDGDNPESR
L
TVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQVG
GPFPQLGSHSGLFQNPVQSEFSSVTSTHSTT
T
EPFLM
DGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASGSLSTHMDQQFFQT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser