NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36130.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36130.1 Public Mus musculus 11 Clint1 21 106 86 CCDS HistoryNCBI Gene:216705Re-query CCDS DB by CCDS ID:36130.1Re-query CCDS DB by GeneID:216705See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36130.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000109260 ENSMUSP00000104883 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109260Link to Ensembl Protein Viewer:ENSMUSP00000104883Re-query CCDS DB by Nucleotide ID:ENSMUST00000109260Re-query CCDS DB by Protein ID:ENSMUSP00000104883
Original member Current member EBI,WTSI OTTMUST00000012200 OTTMUSP00000005627 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012200Link to Vega Protein Viewer:OTTMUSP00000005627Re-query CCDS DB by Nucleotide ID:OTTMUST00000012200Re-query CCDS DB by Protein ID:OTTMUSP00000005627
Original member Current member NCBI NM_001045520.3 NP_001038985.2 Accepted alive Link to Nucleotide Sequence:NM_001045520.3Link to Protein Sequence:NP_001038985.2Re-query CCDS DB by Nucleotide ID:NM_001045520Re-query CCDS DB by Protein ID:NP_001038985Link to BLink:NP_001038985.2

Chromosomal Locations for CCDS 36130.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 45852152 45852192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45883710 45883814 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45884332 45884428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45886431 45886539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45887386 45887550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45890622 45890799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45893871 45894117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45895060 45895129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45902211 45902285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45906181 45906467 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45907894 45908044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 45908941 45909287 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1872 nt):
ATGCTGAACATGTGGAAGGTGCGGGAGCTGGTGGACAAAGCCACCAATGTGGTTATGAATTACTCAGAGA
TT
GAGTCTAAGGTTCGAGAAGCAACGAATGATGATCCCTGGGGACCTTCTGGGCAGCTCATGGGAGAGAT
T
GCCAAGGCTACCTTTATGTATGAGCAGTTCCCAGAACTCATGAACATGCTTTGGTCCCGGATGCTAAAA
GAC
AACAAAAAGAACTGGAGAAGAGTTTATAAGTCGTTGCTGCTCCTAGCTTACCTCATAAGAAATGGAT
CG
GAGCGAGTTGTTACAAGTGCCAGAGAACACATTTATGATTTGCGATCCCTGGAAAATTACCACTTTGT
A
GATGAGCATGGCAAGGATCAAGGTATAAACATTCGACAGAAAGTAAAGGAACTGGTTGAGTTTGCACAG
GAT
GATGACAGGCTTCGAGAAGAGCGAAAGAAAGCAAAGAAGAACAAAGACAAGTATGTCGGGGTCTCTT
CA
GACAGCGTTGGTGGATTCCGATACAATGAGCGGTACGATCCTGAGCCCAAGTCCAAATGGGACGAAGA
G
TGGGATAAGAACAAGAGCGCGTTTCCGTTCAGTGACAAGCTGGGCGAGCTGAGCGACAAGATCGGGAGC
ACG
ATCGACGACACCATCAGCAAGTTCCGGAGGAAAGACCGGGAGGACTCTCCGGAAAGGTGCAGCGACA
GT
GATGAGGAAAAGAAAGCAAGAAGAGGTAGATCTCCCAAAGGTGAATTCAAAGATGAAGAGGAAACGGT
G
ACGACGAAGCATATCCACATCACACAGGCCACAGAGACCACCACAACCCGGCACAAGCGCACAGCAAAC
CCT
TCCAAAACCATTGATCTTGGAGCAGCAGCACATTACACGGGGGACAAAGCCAGCCCAGATCAGAATG
CT
TCAACCCACACGCCTCAGTCGTCAGCCAAGCCATCGGTGCCGAGCAGCAAGTCCTCGGGGGACCTCGT
T
GACCTGTTTGATGGCAGTAGCCAGTCAGCAGGTGGATCAGCTGATTTATTTGGGGGATTTGCTGACTTT
GGC
TCAGCTGCTGCATCAGGCAATTTCCCTTCCCAAGCAACAAGTGGGAATGGTGACTTTGGTGACTGGA
GT
GCCTTCAACCAAGCCCCATCAGGCCCTGTGGCTTCTGGTGGTGAGCTCTTCGGCAGTGCCCCACAGTC
G
GCTGTGGAGCTTATCAGTGCTTCACAGCCAGCTTTAGGCCCACCGCCTGCTGCCTCAAACTCGGCAGAC
CTG
TTTGATCTTATGGGCTCATCCCAGGCAACCATGACGTCTTCCCAGAGCATGAATTTCTCTCTCATGA
GC
ACTAACACCGTGGGACTTGGTTTGCCCATGTCCAGATCACAGAATACAGATATGGTCCAGAAGTCGGC
C
AGCAAAACCCTGCCCTCTACTTGGTCTGACCCCAGTGTCAACATCAGCCTAGACAACTTACTACCTGGT
ATG
CAGCCTTCCAAGCCCCAGCAGCCATCGCTTAATACAATGATTCAACAACAGAATATGCAACAGCCTC
TG
AATGTGATGACACAAAGCTTTGGAGCTGTGAACCTCAGTTCTCCATCAAACATGCTTCCTGTCCGGCC
T
CAAACTAACCCTCTCCTGGGGGGACCCATGCCTATGAACATGCCCGGTGTAATGACGGGCACCATGGGA
ATG
GCCCCTCTGGGGAACAGCGCAGGGATGAGCCAGGGCATGGTGGGCATGAACATGAACATGGGGATGT
CG
GCCTCGGGGATGGGCTTGTCGGGCACCATGGGAATGGGCATGCCCAGCATGGCCATGCCTTCTGGAAC
T
GTGCAACCCAAGCAAGATGCCTTTGCAAACTTTGCCAACTTTAGCAAATAA


Translation (623 aa):
MLNMWKVRELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLK
D
NKKNWRRVYK
SLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQ
D
DDRLREERKKAKKNKDKYVGVSSDSVGGFRY
NERYDPEPKSKWDEEWDKNKSAFPFSDKLGELSDKIGS
T
IDDTISKFRRKDREDSPERC
SDSDEEKKARRGRSPKGEFKDEEETVTTKHIHITQATETTTTRHKRTAN
P
SKTIDLGAAAHYTGDKASPDQNASTHTPQSSAK
PSVPSSKSSGDLVDLFDGSSQSAGGSADLFGGFADF
G
SAAASGNFPSQ
ATSGNGDFGDWSAFNQAPSGPVASGGELFGSAPQSAVELISASQPALGPPPAASNSAD
L
FDLMGSSQATMTSSQSMNFSLMSTNTVGLGLPMSRSQ
NTDMVQKSASKTLPSTWSDPSVNISLDNLLPG
M
QPSKPQQPSLNTMIQQQ
NMQQPLNVMTQSFGAVNLSSPSNMLPVRPQTNPLLGGPMPMNMPGVMTGTMG
M
APLGNSAGMSQGMVGMNMNMGMSASGMGLSGTMGMGMPSMAMPSGTVQPKQDAFANFANFSK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser