NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS35815.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35815.1 Public Mus musculus 1 Tlr5 21 106 86 CCDS HistoryNCBI Gene:53791Re-query CCDS DB by CCDS ID:35815.1Re-query CCDS DB by GeneID:53791See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 35815.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110997 ENSMUSP00000106625 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110997Link to Ensembl Protein Viewer:ENSMUSP00000106625Re-query CCDS DB by Nucleotide ID:ENSMUST00000110997Re-query CCDS DB by Protein ID:ENSMUSP00000106625
Original member Current member NCBI NM_016928.3 NP_058624.2 Accepted alive Link to Nucleotide Sequence:NM_016928.3Link to Protein Sequence:NP_058624.2Re-query CCDS DB by Nucleotide ID:NM_016928Re-query CCDS DB by Protein ID:NP_058624Link to BLAST:NP_058624.2

Chromosomal Locations for CCDS 35815.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 182972435 182972472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 182973171 182975754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2622 nt):
ATGGATGCTGAGTTCCCCCACGCACCACACTTCAGCAGGATCATGGCATGTCAACTTGACTTGCTCATAG
GT
GTGATCTTCATGGCCAGCCCCGTGTTGGTAATATCTCCCTGTTCTTCAGACGGCAGGATAGCCTTTTT
C
CGAGGCTGTAACCTCACCCAGATTCCCTGGATCCTCAATACTACCACTGAGAGGCTCCTGCTCAGCTTC
AAC
TATATCAGTATGGTGGTTGCCACATCATTTCCACTCCTGGAGCGGCTCCAGTTGCTGGAGCTGGGGA
CC
CAGTATGCTAACTTGACCATTGGTCCAGGGGCTTTCAGAAACCTGCCCAATCTTAGGATCTTGGACTT
G
GGCCAAAGCCAGATCGAAGTCTTGAATCGAGATGCCTTTCAAGGTCTGCCCCATCTCTTGGAACTTCGG
CTG
TTTTCCTGTGGACTCTCCAGTGCTGTGTTAAGTGACGGTTACTTCAGAAATCTATATTCATTAGCTC
GC
TTAGACCTATCTGGCAACCAGATTCACAGCCTCCGCCTCCATTCTTCATTCCGGGAACTGAATTCCTT
A
AGCGACGTAAATTTTGCTTTCAACCAAATATTCACTATATGTGAAGATGAACTCGAGCCTCTGCAGGGC
AAA
ACACTGTCTTTCTTTGGCCTCAAATTAACTAAGCTGTTCAGCAGAGTCTCTGTGGGCTGGGAGACAT
GC
AGGAACCCCTTCAGAGGCGTGAGGCTAGAAACTCTAGATCTTTCTGAAAATGGCTGGACGGTGGACAT
C
ACAAGGAACTTCAGCAACATCATCCAGGGAAGCCAGATTTCCTCTTTGATTCTTAAACACCACATCATG
GGT
CCTGGCTTTGGCTTCCAGAACATCAGAGATCCTGACCAGAGCACATTTGCCAGCCTGGCCAGAAGTT
CG
GTGCTGCAACTGGACCTTTCGCACGGCTTTATCTTCTCCTTGAATCCTCGACTGTTTGGGACACTGAA
G
GATTTGAAGATGCTGAACCTTGCCTTCAACAAGATAAACAAGATTGGAGAGAATGCCTTTTATGGGCTT
GAC
AGCCTCCAGGTTCTCAATCTATCCTATAATCTTTTGGGGGAACTCTATAATTCCAACTTCTATGGGC
TT
CCTAGAGTAGCCTACGTTGACCTTCAAAGGAACCACATTGGGATCATTCAAGACCAAACATTCAGATT
A
TTAAAAACGTTACAAACCTTAGATCTCCGTGACAATGCTCTTAAGGCCATTGGTTTTATTCCAAGCATA
CAG
ATGGTCCTCCTGGGAGGCAATAAGCTGGTCCATTTGCCACACATCCACTTTACTGCCAACTTCCTAG
AG
TTATCTGAAAACAGGCTAGAAAACCTGTCCGACCTCTACTTCCTCCTGCGAGTCCCCCAGCTCCAGTT
T
CTCATCTTGAATCAGAATCGCCTTTCGTCATGCAAGGCAGCCCACACTCCCTCGGAGAACCCAAGCTTA
GAA
CAGCTTTTCCTTACAGAGAATATGCTGCAGCTGGCCTGGGAGACCGGCCTCTGTTGGGATGTTTTTC
AA
GGCCTTTCCCGCCTCCAGATTCTTTACCTGAGTAATAACTACCTTAATTTCCTTCCACCTGGGATATT
T
AACGACCTGGTTGCATTACGGATGCTTAGTCTTAGTGCTAACAAGCTGACCGTGCTCTCTCCGGGCAGT
TTA
CCTGCTAATTTAGAGATTCTCGACATATCTAGAAATCAGCTTTTCTCTCCTGACCCTGCTTTGTTTT
CT
TCGCTTCGTGTTTTGGACATAACTCATAACGAGTTCGTCTGCAACTGTGAACTTAGCACTTTTATCTC
C
TGGCTCAACCAAACCAACGTCACCCTGTTCGGCTCTCCTGCAGACGTGTATTGCATGTACCCTAACTCA
CTG
CTAGGGGGCTCCCTCTACAACATATCCACCGAAGACTGCGATGAAGAGGAAGCCATGCGGTCCCTAA
AG
TTTTCCCTTTTCATCCTGTGCACGGTCACTTTGACTCTATTCCTCGTCATCACCCTTGTAGTCATAAA
G
TTCCGGGGAATCTGTTTCCTGTGCTATAAGACCATCCAGAAGCTGGTGTTCAAGGACAAGGTCTGGAGT
TTG
GAACCTGGTGCATATAGATATGATGCCTACTTCTGCTTCAGCAGCAAAGACTTTGAATGGGCACAGA
AT
GCTTTGCTCAAACACCTGGATGCTCACTACAGTTCCCGAAACAGGCTCAGGCTATGCTTTGAAGAAAG
A
GACTTCATTCCGGGGGAAAACCATATCTCCAACATCCAGGCGGCTGTCTGGGGCAGCAGGAAGACGGTG
TGT
CTAGTGAGCAGACACTTCCTGAAGGATGGTTGGTGCCTGGAGGCCTTCAGGTATGCCCAGAGCCGGA
GT
CTGTCTGACCTCAAGAGCATTCTCATCGTGGTGGTGGTGGGATCGCTGTCCCAGTATCAGCTGATGAG
A
CATGAGACCATCAGAGGGTTTCTGCAAAAGCAACAGTACTTGAGGTGGCCTGAAGACCTCCAGGATGTT
GGC
TGGTTTCTCGATAAACTCTCCGGATGCATTCTAAAGGAAGAAAAAGGAAAGAAAAGAAGCAGTTCCA
TC
CAGTTGCGAACCATAGCAACCATTTCCTAG


Translation (873 aa):
MDAEFPHAPHFSRIMACQLDLLIGVIFMASPVLVISPCSSDGRIAFFRGCNLTQIPWILNTTTERLLLSF
N
YISMVVATSFPLLERLQLLELGTQYANLTIGPGAFRNLPNLRILDLGQSQIEVLNRDAFQGLPHLLELR
L
FSCGLSSAVLSDGYFRNLYSLARLDLSGNQIHSLRLHSSFRELNSLSDVNFAFNQIFTICEDELEPLQG
K
TLSFFGLKLTKLFSRVSVGWETCRNPFRGVRLETLDLSENGWTVDITRNFSNIIQGSQISSLILKHHIM
G
PGFGFQNIRDPDQSTFASLARSSVLQLDLSHGFIFSLNPRLFGTLKDLKMLNLAFNKINKIGENAFYGL
D
SLQVLNLSYNLLGELYNSNFYGLPRVAYVDLQRNHIGIIQDQTFRLLKTLQTLDLRDNALKAIGFIPSI
Q
MVLLGGNKLVHLPHIHFTANFLELSENRLENLSDLYFLLRVPQLQFLILNQNRLSSCKAAHTPSENPSL
E
QLFLTENMLQLAWETGLCWDVFQGLSRLQILYLSNNYLNFLPPGIFNDLVALRMLSLSANKLTVLSPGS
L
PANLEILDISRNQLFSPDPALFSSLRVLDITHNEFVCNCELSTFISWLNQTNVTLFGSPADVYCMYPNS
L
LGGSLYNISTEDCDEEEAMRSLKFSLFILCTVTLTLFLVITLVVIKFRGICFLCYKTIQKLVFKDKVWS
L
EPGAYRYDAYFCFSSKDFEWAQNALLKHLDAHYSSRNRLRLCFEERDFIPGENHISNIQAAVWGSRKTV
C
LVSRHFLKDGWCLEAFRYAQSRSLSDLKSILIVVVVGSLSQYQLMRHETIRGFLQKQQYLRWPEDLQDV
G
WFLDKLSGCILKEEKGKKRSSSIQLRTIATIS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser