NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30541.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30541.1 Public Mus musculus Y Kdm5d 21 106 86 CCDS HistoryNCBI Gene:20592Re-query CCDS DB by CCDS ID:30541.1Re-query CCDS DB by GeneID:20592See the combined annotation on chromosome Y in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30541.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055032 ENSMUSP00000061095 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055032Link to Ensembl Protein Viewer:ENSMUSP00000061095Re-query CCDS DB by Nucleotide ID:ENSMUST00000055032Re-query CCDS DB by Protein ID:ENSMUSP00000061095
Original member Current member EBI,WTSI OTTMUST00000118913 OTTMUSP00000066308 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118913Link to Vega Protein Viewer:OTTMUSP00000066308Re-query CCDS DB by Nucleotide ID:OTTMUST00000118913Re-query CCDS DB by Protein ID:OTTMUSP00000066308
Original member Current member NCBI NM_011419.3 NP_035549.1 Accepted alive Link to Nucleotide Sequence:NM_011419.3Link to Protein Sequence:NP_035549.1Re-query CCDS DB by Nucleotide ID:NM_011419Re-query CCDS DB by Protein ID:NP_035549Link to BLink:NP_035549.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035549.1 1548 Q62240-1 1548 100% 0 0

Chromosomal Locations for CCDS 30541.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome Y (NC_000087.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome YLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome YSee the combined annotation on chromosome Y in Sequence Viewer

Chromosome Start Stop Links
Y 897966 898115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 898550 898627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 899428 899550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 899787 899957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 900479 900613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 910448 910586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 910686 910849 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 914025 914183 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 916641 916760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 916846 917004 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 921402 921583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 921674 921836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 927007 927126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 927245 927439 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 927710 927891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 927970 928094 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 928237 928384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 936876 936972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 937813 938171 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 939819 939957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 940599 940778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 940905 941042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 941227 941823 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 942231 942312 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 942442 942641 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y
Y 942824 943165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome YLink to Ensembl Genome Browser on chromosome YLink to Vega Genome Browser on chromosome Y

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4647 nt):
ATGAAGCCAGGATCTGACGACTTTCTACCGCCGCCTGAGTGCCCTGTGTTTGAGCCCAGTTGGGCGGAAT
TC
CGCGATCCTCTTGGCTATATAGCTAAAATCAGACCCATTGCGGAGAAATCAGGCATTTGCAAGATACG
C
CCACCTGCGGATTGGCAACCTCCTTTTGCTGTAGAAGTTGATAACTTCAGATTTACTCCTCGAATTCAG
AGG
CTAAATGAACTGGAGGCCCAGACCAGAGTAAAACTGAACTATTTGGATCAGATTGCAAAGTTCTGGG
AA
ATTCAAGGTTCTTCCTTAAAGATACCTAATGTGGAGAGGAAGATCTTGGACCTTTACAGCCTTAATAA
G
ATTGTGATGGAGGAAGGTGGATATGAAGCAATCTGCAAGGACCGTCGGTGGGCCCGTGTTGCCCAACGC
CTT
AATTACCCATCAGGGAAAAACATTGGTTCCCTGCTTCGGTCCCACTACGAACGGATCATTTACCCTT
AT
GAAATATTTCAGTCTGGAGCTAATCTTGTGCAATGTAACACAGATCCATTTGACAGTGAAGAAAGAGA
C
AAGGAATACAAACCTCATAGCATTCCTCTTAGACAGTCTGTTCAGCCATCAAAATTCAGTTGCTACAGT
AGA
CGAGGAAAAAGGCTACAGCCTGAGCCAGAACCCACAGAAGAAGACATTGAGAAAAACCCAGAGCTAA
AG
AAACTACAGATATATGGGGCAGGCCCCAAGATGATAGGCTTGGGCCTCAAGGCTAAGGAGAAAACTCT
G
AGAAAGAAAGATAGCAAACAACCAGATAAAGAAGAAGTGACATGCCCTGCAACTATTGTAGTGAAGGGG
GAA
GCCAGTGAGTTTGGAAAGGTGACATCAGCATTTTCAGACAAGAACTTAAATCACAGTTTTGAACCTT
GT
ATGAAGATGACTATGCAGCTACGGAACAATCACAGCAGTACCCAGTTTATGAATTCATATGTTTGCCG
A
ATATGCTCTCGTGGGGATGAAGTCGATAAGTTTCTGCTCTGTGATGGCTGCAGTGATAATTACCACATC
TTT
TGCCTATTGCCACCGCTTTCTGAAGTCCCCAAGGGAGTATGGAGATGCCCGAAGTGTATCTTAGCAG
AG
TGTAAGAGTCCCCCTGAAGCTTTTGGCTTTGAGCAGGCTACACAGGAGTATACTTTGCAGAGTTTTGG
T
GAGATGGCTGACTCCTTCAAGGCTGACTACTTCAACATGCCTGTGCATATGGTACCTACAGAAGTTGTG
GAA
AAGGAATTCTGGAGGCTGGTGAGCAGCATTGAGGAGGATGTGACAGTTGAATATGGAGCAGACATTC
AC
TCCAAAGAATTTGGCAGTGGGTTTCCTGTCAACAATAGCAAATGGGACTTATCTCCTGAAGAAAAGGA
A
TATGCTGCTTGTGGTTGGAATCTCAATGTGATGCCAGTGCTGGATCAGTCTGTTCTCTGCCACATCAAT
GCA
GACATCTCAGGCATGAAAGTGCCCTGGTTATATGTGGGCATGGTGTTTTCAGCATTTTGTTGGCATA
TT
GAGGATCACTGGAGTTATTCCATTAACTACCTGCACTGGGGTGAACCAAAGACCTGGTATGGAGTACC
T
TCGCTAGCAGCAGAACACTTAGAGGATGTAATGAAGAGACTTACACCAGAGTTGTTTGACAGCCAACCT
GAC
CTCCTGCACCAACTTGTCACTCTGATGAATCCTAACACTCTCATGTCACATGGAGTGCCAGTTGTTC
GT
ACAAACCAGTGTGCAGGGGAATTTGTCATTACTTTTCCCCGTGCTTACCACAGTGGCTTTAACCAAGG
C
TATAACTTTGCTGAGGCAGTGAACTTTTGCACTGCCGATTGGCTACCTGTTGGACGCCAGTGTATTGAA
CAC
TACCGCCGACTCCGGCGCTATTGTGTCTTCTCCCATGAAGAACTTATCTGCAAGATGGCTGCATTTC
CA
GAGAAGTTGGATCTAAATCTAGCAGTGGCAGTTCACAAGGAGATGTTCATTATGGTACAGGAGGAGCG
A
CGCCTACGAAAGACCTTGTTGGAGAAGGGCATCACGGAAGCTGAGCGAGAGGCTTTTGAGCTACTCCCA
GAT
GATGAGCGTCAGTGCATCAAGTGTAAGACCACGTGTTTCCTATCAGCCTTGGCCTGTTATGACTGTC
CA
GATAGTCTTGTCTGCCTTTCCCATATCAATGATCTGTGCAAGTGCTCAAGGAATCGACAGTACTTACG
G
TACAGGTACACATTGGATGAACTGCCTGCTATGCTACAAAAGCTGAAGATTCGAGCTGAGTCATTTGAC
AAC
TGGGCCAACAAAGTACAAGCAGCCCTAGAGGTGGAGGATGGTCGGAAACGGAGTTTTGAAGAGCTAA
GA
GCATTGGAATCTGAGGCTCGTGATAGACGATTTCCTAATAGTGAGCTGCTTCAGCGATTGAAGAAATG
C
CTAACTGAAGCAGAGGCTTGTATTTCCCAAGTTCTTGGACTGATCAGTAACTCAGAGGACAGGTTACAA
ACA
CCGCAAATCACCCTTACTGAACTACAGCTTCTTCTCAAACAGATGGGCACTCTGCCCTGTACCATGC
AT
CAGATTGATGAAGTTAAGGATGTTCTTCAACAGGTGGAATCATACCAAATTGAGACCCGTGAGGCTCT
A
ACTTCACTGCCTTACAGTTTAGAAATACTTCAGTCCCTGATGGAAAAGGGTCAGCAGCTTCGTGTGGAA
GTG
CCTGAAGCTCATCAACTTGAAGAGCTGTTGGAGCAGGCACAATGGCTAGATCAAGTGAAGCAGGCCC
TG
GCTCCCTCAGGCCAGAGGCACTCTTTGGTTATCATGAAGAAGCTTTTAGTTATGGGAACCAAGGTAGC
C
TCCAGCCCTTCTGTGAACAAAGCTCGAGCAGAGTTACAAGAACTGCTGACTATTGCAGAATGTTGGGAG
GAA
AAGGCCCATTTTTGCTTAAAAGCTAGCCAAAAGCATTCTCCAGCCACTTTGGAAGTTATAATACGTG
AG
GCAGAAAACATCCCTGTCTACCTACCTAACATCCAGTCTCTGAAGGAAGCTCTGACTAAGGCACAGGC
T
TGGATTGCTGATGTGAATGAGATTCAAAATGGTGATCACTACCCCTGTTTGGATGATTTGGAGGGCCTT
GTA
GCTGTTGGTCGGGATTTACCTGTGGAGCTAGAGGAATTGAGACAGCTGGAGAATCAGGTACTAACAG
CA
CATTCCTGGAAAGAGAAAGCTTCTAAGACTTTTCTTAAGAAGAATTCTTGCTACACATTGTTGGAGGT
T
CTCTGCCCATGTGCAGATGCTGGTTCAGTCAGCACCAAGCGCAGTCGGTGGATTGAAAAGGAGATGGGA
TTA
TACAAATATGACACAGAATTGCTGGGGCTGTCTGCACAGGACCTCAGGGACCCAGGGTCTGTGATCA
TG
GCCTTTAAGGAAGGGGAAGAGAAAGAAAAGGAAGGTATCTTGCACTTACGTCACATCAACTCAGCCAA
G
CCCAGTCCAATGTCCTCATCGATGAATGCCTCTGCAACCTCCATCTGTATATGTGGGCAGGTCTGTGCA
GGA
GTGGAATCTCTGCAGTGTGATCTTTGTCATGACTGGTTCCATGGACAATGTGTGACTGTACCCCACC
TA
CTCAGCTCAGTAAGGGCCAGTCATACCTCATCTCAACTGCTAGCTTGGTGGGAATGGGACACCAAGTT
C
CTGTGCCCACTGTGCATGCGATCAAGGCGTCCACGCCTGGAGACCATCTTGTCATTGCTGGTAGGACTA
CAG
AGACTGTCTGTAAGGCTACCTGAGGGTGAGGCCCTACAGTGCCTCACAGAGAGAGCCATTGGTTGGC
AA
GGCCGTGCCAGGCAGGCTCTAGCTTCTGAGGATGTGACTGCTTTGTTGAAACAGCTGGAAAAATCCCG
C
CAACAACTACAGGATGAATTGAGACATAAGAAGCCCCCTACCTTGCCTTCAGGCTTTGCCTTTGACTGT
CTC
ACAGAGAATAGTGGCAAGGATATCCTTAAGGAAGAGGAGGAGTTGGTACTAAATGAAGAAAGGATTA
AA
AGTTCTGAGAAGATTGTTCCAAAGGAAAGTTCATGTAAAGGAGATAAGGAACTGCTGCCTTCACTTTT
A
TCCCAATTAACTGGCCCAGTACTGGAACTGCCTGAAGCCACCCGGGCACCCCTAGAGGAGCTTATGATG
GAA
GGAGATCTACTTGAAGTTACCCTAGATGAGAACTACAGCATTTGGCAGCTGCTGCAGGCTGGGCAGA
AT
CCCAATCTAGAGCGCATTCATACACTTCTGGAGCTTGAGAAGCCTGAAAACCCAGGAAATTGGTCAGA
G
GAACAGACACCAGAGAGGCGACGGCAGAGGAGGCAAAAGGTGGTTCTGAGTAGAAAGGGTGAGGATTTT
ACT
CAAAAAGAGCTAGAATCAAAAAGAGTCAAGAGTTCAAGGATTAAGCCTAAGGAAGAAAAGTTTCAAA
AG
CCAATACTTGGGGATAATGTGCTGTACACACACCATACAGAACATACAAACATCTTAAAAGAGCACAT
A
AACAGTGTACAAGGAAAGGATCCAAGCCCTTCATCTTCTTTTCCTTCCTTAACACCTTTACTACACCTA
TCT
TATTTTCATCAGCAAAAATTATAA


Translation (1548 aa):
MKPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEVDNFRFTPRIQ
R
LNELE
AQTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLNKIVMEEGGYEAICKDRRWARVAQR
L
NYPSGKNIGSLLRSHYERIIYPYEIFQSGANLV
QCNTDPFDSEERDKEYKPHSIPLRQSVQPSKFSCYS
R
RGKRLQPE
PEPTEEDIEKNPELKKLQIYGAGPKMIGLGLKAKEKTLRKKDSKQPDKEEVTCPATIVVKG
E
ASEFGKVTSAFSDKNLNHSFEPCMKMTMQLRNNHSSTQF
MNSYVCRICSRGDEVDKFLLCDGCSDNYHI
F
CLLPPLSEVPKGVWRCPKCILA
ECKSPPEAFGFEQATQEYTLQSFGEMADSFKADYFNMPVHMVPTEVV
E
KEFWRLVSSIEEDVTVEYGADIHSKEFGSGFPVNNSKWDLSPEEK
EYAACGWNLNVMPVLDQSVLCHIN
A
DISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLH
WGEPKTWYGVPSLAAEHLEDVMKRLTPELFDSQP
D
LLHQLVTLMNPNTLMSHGVP
VVRTNQCAGEFVITFPRAYHSGFNQGYNFAEAVNFCTADWLPVGRQCIE
H
YRRLRRYCVFSHEELICKMAAFPEKLDLNLAVAVHKEMFIMVQEERRLRKTLLEK
GITEAEREAFELLP
D
DERQCIKCKTTCFLSALACYDCPDSLVCLSHINDLCKCSRNRQYL
RYRYTLDELPAMLQKLKIRAESFD
N
WANKVQAALEVEDGRKR
SFEELRALESEARDRRFPNSELLQRLKKCLTEAEACISQVLGLISNSEDRLQ
T
PQITLTELQLLLKQMGTLPCTMHQIDEVK
DVLQQVESYQIETREALTSLPYSLEILQSLMEKGQQLRVE
V
PEAHQLEELLEQAQWLDQVKQALAPSGQRHSLVIMKKLLVMGTKVASSPSVNKARAELQELLTIAECWE
E
KAHFCLKA
SQKHSPATLEVIIREAENIPVYLPNIQSLKEALTKAQAWIADVNEIQNGDHYPCLDDLEGL
V
AVGRDLPVELEELRQLENQVLTAHSWKEKASKTFLKKNSCYTLLE
VLCPCADAGSVSTKRSRWIEKEMG
L
YKYDTELLGLSAQDLRDPGSV
IMAFKEGEEKEKEGILHLRHINSAKPSPMSSSMNASATSICICGQVCA
G
VESLQCDLCHDWFHGQCVTVPHLLSSVRASHTSSQLLAWWEWDTKFLCPLCMRSRRPRLETILSLLVGL
Q
RLSVRLPEGEALQCLTERAIGWQGRARQALASEDVTALLKQLEKSRQQLQDELRHKKPPTLPSGFAFDC
L
TENSGKDILK
EEEELVLNEERIKSSEKIVPKESSCKGDKELLPSLLSQLTGPVLELPEATRAPLEELMM
E
GDLLEVTLDENYSIWQLLQAGQNPNLERIHTLLE
LEKPENPGNWSEEQTPERRRQRRQKVVLSRKGEDF
T
QKELESKRVKSSRIKPKEEKFQKPILGDNVLYTHHTEHTNILKEHINSVQGKDPSPSSSFPSLTPLLHL
S
YFHQQKL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser