NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30398.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30398.1 Public Mus musculus X Armcx1 21 106 86 CCDS HistoryNCBI Gene:78248Re-query CCDS DB by CCDS ID:30398.1Re-query CCDS DB by GeneID:78248See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30398.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035748 ENSMUSP00000043965 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035748Link to Ensembl Protein Viewer:ENSMUSP00000043965Re-query CCDS DB by Nucleotide ID:ENSMUST00000035748Re-query CCDS DB by Protein ID:ENSMUSP00000043965
Original member Current member EBI,WTSI ENSMUST00000051256 ENSMUSP00000053909 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051256Link to Ensembl Protein Viewer:ENSMUSP00000053909Re-query CCDS DB by Nucleotide ID:ENSMUST00000051256Re-query CCDS DB by Protein ID:ENSMUSP00000053909
Original member Current member EBI,WTSI ENSMUST00000113197 ENSMUSP00000108822 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113197Link to Ensembl Protein Viewer:ENSMUSP00000108822Re-query CCDS DB by Nucleotide ID:ENSMUST00000113197Re-query CCDS DB by Protein ID:ENSMUSP00000108822
Original member Current member EBI,WTSI ENSMUST00000113198 ENSMUSP00000108823 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113198Link to Ensembl Protein Viewer:ENSMUSP00000108823Re-query CCDS DB by Nucleotide ID:ENSMUST00000113198Re-query CCDS DB by Protein ID:ENSMUSP00000108823
Original member Current member EBI,WTSI ENSMUST00000113199 ENSMUSP00000108824 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113199Link to Ensembl Protein Viewer:ENSMUSP00000108824Re-query CCDS DB by Nucleotide ID:ENSMUST00000113199Re-query CCDS DB by Protein ID:ENSMUSP00000108824
Original member Current member EBI,WTSI ENSMUST00000113201 ENSMUSP00000108826 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113201Link to Ensembl Protein Viewer:ENSMUSP00000108826Re-query CCDS DB by Nucleotide ID:ENSMUST00000113201Re-query CCDS DB by Protein ID:ENSMUSP00000108826
Original member Current member EBI,WTSI OTTMUST00000046388 OTTMUSP00000020944 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046388Link to Vega Protein Viewer:OTTMUSP00000020944Re-query CCDS DB by Nucleotide ID:OTTMUST00000046388Re-query CCDS DB by Protein ID:OTTMUSP00000020944
Original member Current member EBI,WTSI OTTMUST00000046389 OTTMUSP00000020945 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046389Link to Vega Protein Viewer:OTTMUSP00000020945Re-query CCDS DB by Nucleotide ID:OTTMUST00000046389Re-query CCDS DB by Protein ID:OTTMUSP00000020945
Original member Current member EBI,WTSI OTTMUST00000046390 OTTMUSP00000020946 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046390Link to Vega Protein Viewer:OTTMUSP00000020946Re-query CCDS DB by Nucleotide ID:OTTMUST00000046390Re-query CCDS DB by Protein ID:OTTMUSP00000020946
Original member Current member EBI,WTSI OTTMUST00000046391 OTTMUSP00000020947 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046391Link to Vega Protein Viewer:OTTMUSP00000020947Re-query CCDS DB by Nucleotide ID:OTTMUST00000046391Re-query CCDS DB by Protein ID:OTTMUSP00000020947
Original member Current member EBI,WTSI OTTMUST00000046392 OTTMUSP00000020948 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046392Link to Vega Protein Viewer:OTTMUSP00000020948Re-query CCDS DB by Nucleotide ID:OTTMUST00000046392Re-query CCDS DB by Protein ID:OTTMUSP00000020948
Original member Current member EBI,WTSI OTTMUST00000046456 OTTMUSP00000020976 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046456Link to Vega Protein Viewer:OTTMUSP00000020976Re-query CCDS DB by Nucleotide ID:OTTMUST00000046456Re-query CCDS DB by Protein ID:OTTMUSP00000020976
Original member Current member NCBI NM_001166377.1 NP_001159849.1 Accepted alive Link to Nucleotide Sequence:NM_001166377.1Link to Protein Sequence:NP_001159849.1Re-query CCDS DB by Nucleotide ID:NM_001166377Re-query CCDS DB by Protein ID:NP_001159849Link to BLAST:NP_001159849.1
Original member Current member NCBI NM_001166378.1 NP_001159850.1 Accepted alive Link to Nucleotide Sequence:NM_001166378.1Link to Protein Sequence:NP_001159850.1Re-query CCDS DB by Nucleotide ID:NM_001166378Re-query CCDS DB by Protein ID:NP_001159850Link to BLAST:NP_001159850.1
Original member Current member NCBI NM_001166379.1 NP_001159851.1 Accepted alive Link to Nucleotide Sequence:NM_001166379.1Link to Protein Sequence:NP_001159851.1Re-query CCDS DB by Nucleotide ID:NM_001166379Re-query CCDS DB by Protein ID:NP_001159851Link to BLAST:NP_001159851.1
Original member Current member NCBI NM_001166380.1 NP_001159852.1 Accepted alive Link to Nucleotide Sequence:NM_001166380.1Link to Protein Sequence:NP_001159852.1Re-query CCDS DB by Nucleotide ID:NM_001166380Re-query CCDS DB by Protein ID:NP_001159852Link to BLAST:NP_001159852.1
Original member Current member NCBI NM_030066.3 NP_084342.1 Accepted alive Link to Nucleotide Sequence:NM_030066.3Link to Protein Sequence:NP_084342.1Re-query CCDS DB by Nucleotide ID:NM_030066Re-query CCDS DB by Protein ID:NP_084342Link to BLAST:NP_084342.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159849.1 456 Q9CX83 456 100% 0 0
NP_001159850.1 456 Q9CX83 456 100% 0 0
NP_001159851.1 456 Q9CX83 456 100% 0 0
NP_001159852.1 456 Q9CX83 456 100% 0 0
NP_084342.1 456 Q9CX83 456 100% 0 0

Chromosomal Locations for CCDS 30398.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 134720151 134721521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1371 nt):
ATGGGTCGCACCCGGGAAGCTGGATGTGTGGCTGCAGGCATGGTCATTGGGGCTGGTGCCTGCTACTGTG
TA
TACAGACTGACCTGGGGAAAAGATGAGAATGAGAAGTTGTGGGATGAGGAAGAGGAGGAAGAGGAGGA
A
GAGGAGGAAAAGTCTTGTAGTGACAAAACTGAGAAAGAACTTAAGACTAATGTTGGGGTAGGGGCGAGA
GGC
AAACCTCAAGATGACTCAAAGTCCAAGGTTGAGGTGAATGTGGGACCTGAGAATGGTCCAGGTGTAA
AG
AAAGAAGTGCACCCAGAATCCCAGAGTGGGGGTGGACTAGAGGCTAAGGCCAAGGCCCTTTTCAAGAC
T
CTAAAGGAACAGGCACGTGCAAAGGCAGGCAGAGGCATAAGGCTTCCTAACATCTCTAGGAATAGGACC
CTG
ACATCAAGTTTGCCTTGCCCAGGAGGCAGGGGTGGAGGCTGCCACCCGGGAAGGACTGGTTCTAGGG
CT
AGGAACAGGACAAGTGGGAAAGTCAAGAGAAAGAACCGAAGCAAGAGCAACAAGGCTCCAGCCACAGC
A
TGGCCTGTACGCAAGGGCAAGTTCAGCTTTCCCTATAAAATTGATGATATTCTGAGCGCCCCTGATCTT
CAA
AAGGTCCTGAACATCCTGGAGAGAACAAATGACCCTTTTACTCAGGAAGTAGCACTGGTCACACTGG
GT
AACAATGCAGCATATTCATTTAATCAAAACGCCATCCGTGAGCTGGGTGGAGTCCCCATTATTGCAAA
G
CTGATAAAAACAAGAGACCCCATTATTAGGGAAAAGACTTACAATGCTCTTAATAACTTGAGCGTTAAT
TCT
GAGAATCAGGGCAAGATTAAGACTTATATCAGTCAAGTGTGTGACGATACCATGGTTTGCCGCTTGG
AC
TCAGCCGTCCAGATGGCTGGATTAAGACTCCTTACCAACATGACTGTAACTAATCACTACCAACATTT
G
CTTTCCTATTCTTTCCCAGATTTCTTTGCTTTGTTATTCCTGGGAAACCACTTCACCAAGATACAGACT
ATG
AAACTGATTATAAATTTTACTGAAAACCCAGCCATGACAAGAGAGCTGGTCAGTTGTAAAGTACCTT
CG
GAATTGATTTCTCTGTTTAATAAAGAATGGGATAGAGAGATTCTTCTTAACATTCTTACCCTCTTTGA
A
AATATAAACGATAACATAAAAAGTGAAGGGCTTGCATCCTCCAGGAAGGAATTCAGCAGGAGCTCACTG
TTT
TTCTTATTTAAAGAGTCTGGAGTATGTGTGAAGAAAATCAAAGCATTAGCAAGCCATAAGGATCTGG
TG
GTCAAAGTGAAAGTTCTAAAAGTCTTAACAAAATTATAA


Translation (456 aa):
MGRTREAGCVAAGMVIGAGACYCVYRLTWGKDENEKLWDEEEEEEEEEEEKSCSDKTEKELKTNVGVGAR
G
KPQDDSKSKVEVNVGPENGPGVKKEVHPESQSGGGLEAKAKALFKTLKEQARAKAGRGIRLPNISRNRT
L
TSSLPCPGGRGGGCHPGRTGSRARNRTSGKVKRKNRSKSNKAPATAWPVRKGKFSFPYKIDDILSAPDL
Q
KVLNILERTNDPFTQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTRDPIIREKTYNALNNLSVN
S
ENQGKIKTYISQVCDDTMVCRLDSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQT
M
KLIINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKSEGLASSRKEFSRSSL
F
FLFKESGVCVKKIKALASHKDLVVKVKVLKVLTKL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser