NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30332.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30332.1 Public Mus musculus X Zdhhc15 21 106 86 CCDS HistoryNCBI Gene:108672Re-query CCDS DB by CCDS ID:30332.1Re-query CCDS DB by GeneID:108672See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30332.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000042070 ENSMUSP00000047615 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042070Link to Ensembl Protein Viewer:ENSMUSP00000047615Re-query CCDS DB by Nucleotide ID:ENSMUST00000042070Re-query CCDS DB by Protein ID:ENSMUSP00000047615
Original member Current member EBI,WTSI OTTMUST00000043702 OTTMUSP00000019629 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043702Link to Vega Protein Viewer:OTTMUSP00000019629Re-query CCDS DB by Nucleotide ID:OTTMUST00000043702Re-query CCDS DB by Protein ID:OTTMUSP00000019629
Original member Current member NCBI NM_175358.4 NP_780567.1 Accepted alive Link to Nucleotide Sequence:NM_175358.4Link to Protein Sequence:NP_780567.1Re-query CCDS DB by Nucleotide ID:NM_175358Re-query CCDS DB by Protein ID:NP_780567Link to BLink:NP_780567.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780567.1 337 Q8BGJ0 337 100% 0 0

Chromosomal Locations for CCDS 30332.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 104544858 104544904 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104560685 104560788 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104563821 104563947 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104565702 104565834 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104571654 104571774 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104572505 104572537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104574169 104574238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104588301 104588421 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104598092 104598186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104632584 104632610 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104670664 104670799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1014 nt):
ATGCGGCGGGGCTGGAAGATGGCTCTGTCTGGGGGGTTGCGGTGCTGCCGCCGGGTACTGTCCTGGGTGC
CA
GTGCTCGTTATTGTCCTCGTCGTTCTCTGGTCCTACTATGCCTACGTCTTTGAACTCTGCCTGGTGAC
T
GTTTTGAGTCCAGCGGAAAAAGTTATCTACCTCATACTCTATCATGCCATTTTTGTGTTCTTTGCATGG
ACC
TACTGGAAGTCTATCTTCACACTCCCACAGCAGCCAAACCAGAAGTTCCACTTGTCCTATACAGACA
AG
GAGCGCTATAAAAATGAAGAGAGACCTGAGGTCCAGAAGCAGATGCTTGTGGACATGGCCAAGAAGTT
A
CCAGTGTACACAAGAACCGGGAGTGGAGCTGTACGGTTCTGTGACCGGTGCCATCTAATCAAGCCAGAC
CGC
TGCCATCACTGTTCTGTCTGTGCCATGTGTGTTTTAAAAATGGACCATCACTGCCCATGGGTTAATA
AC
TGCATTGGATTTTCCAACTACAAATTCTTCCTTCAGTTCTTAGCTTATTCCGTTCTCTACTGCCTGTA
C
ATTGCTACAACAGTCTTCAGCTACTTCATCAAATACTGGAGAGGGGAATTGCCCAGTGTTCGCTCTAAG
TTC
CATGTCCTCTTTCTCCTCTTTGTGGCCTGCATGTTTTTTGTCAGCCTTGTGATTCTCTTTGGTTACC
AT
TGTTGGCTTGTCAGCAGAAACAAAACTACCTTAGAGGCCTTCTGCACACCAGTATTCACAAGTGGACC
A
GAGAAAAATGGGTTCAATCTTGGCTTCATCAAGAATATTCAGCAGGTGTTTGGCGATAATAAGAAGTTC
TGG
TTAATACCCATTGGGTCCAGCCCTGGTGATGGACACTCCTTCCCTATGAGGTCTATGAATGAGTCAC
AG
AACCCGCTGCTGGCAAATGAGGAACCCTGGGAAGACAATGAGGATGATAGTCGAGATTATCCAGAAGG
C
TCATCATCACTTGCTGTGGAGTCGGAAACGTAG


Translation (337 aa):
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFAW
T
YWKSIFTLPQQPNQK
FHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPD
R
CHHCSVCA
MCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSK
F
HVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTL
EAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKF
W
LIPIGS
SPGDGHSFPMRSMNESQNPLLANEEPWEDNEDDSRDYPEGSSSLAVESET



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser