NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30151.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30151.1 Public Mus musculus X Vgll1 21 106 86 CCDS HistoryNCBI Gene:170828Re-query CCDS DB by CCDS ID:30151.1Re-query CCDS DB by GeneID:170828See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30151.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033465 ENSMUSP00000033465 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033465Link to Ensembl Protein Viewer:ENSMUSP00000033465Re-query CCDS DB by Nucleotide ID:ENSMUST00000033465Re-query CCDS DB by Protein ID:ENSMUSP00000033465
Original member Current member EBI,WTSI ENSMUST00000114745 ENSMUSP00000110393 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114745Link to Ensembl Protein Viewer:ENSMUSP00000110393Re-query CCDS DB by Nucleotide ID:ENSMUST00000114745Re-query CCDS DB by Protein ID:ENSMUSP00000110393
Original member Current member EBI,WTSI ENSMUST00000114746 ENSMUSP00000110394 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114746Link to Ensembl Protein Viewer:ENSMUSP00000110394Re-query CCDS DB by Nucleotide ID:ENSMUST00000114746Re-query CCDS DB by Protein ID:ENSMUSP00000110394
Original member Current member EBI,WTSI OTTMUST00000043048 OTTMUSP00000019347 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043048Link to Vega Protein Viewer:OTTMUSP00000019347Re-query CCDS DB by Nucleotide ID:OTTMUST00000043048Re-query CCDS DB by Protein ID:OTTMUSP00000019347
Original member Current member NCBI NM_001313763.1 NP_001300692.1 Accepted alive Link to Nucleotide Sequence:NM_001313763.1Link to Protein Sequence:NP_001300692.1Re-query CCDS DB by Nucleotide ID:NM_001313763Re-query CCDS DB by Protein ID:NP_001300692Link to BLAST:NP_001300692.1
Original member Current member NCBI NM_133251.2 NP_573514.1 Accepted alive Link to Nucleotide Sequence:NM_133251.2Link to Protein Sequence:NP_573514.1Re-query CCDS DB by Nucleotide ID:NM_133251Re-query CCDS DB by Protein ID:NP_573514Link to BLAST:NP_573514.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001300692.1 307 Q99NC0 307 100% 0 0
NP_573514.1 307 Q99NC0 307 100% 0 0

Chromosomal Locations for CCDS 30151.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 57092273 57092486 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 57096263 57096316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 57099161 57099223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 57101629 57102123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 57104091 57104144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 57105403 57105446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (924 nt):
ATGGAGGAAATGAAGAAGAATGGTGTCTGGATACCTGAAAGCAGTCAAAAACCGGTAAAGACAGAGTGGA
AC
GCCGGTTCTGTCATTTTCACCTACTTCGAAGGGGACATCAACAGTATGGTGGATGAACATTTCTCCAG
A
GCTCTGCGTAACCTCAAGAGGCCCCACAAATGCAGTTCCTCAAGTCACAGTGACAATTTGACCCTCAAG
AAC
GGGGTGAATAAAACACGGACGGACACCAGCCACACGGATAGAGAGCGCAAAGTCGAATCCAGTCAAA
CT
GAAAATTCAGGAGAACTGAAAGACGTGCCTGTGGAGGAGAAGGGAACCAATAAGAGCATGCCCCCGAA
T
CAGAGGCATCTCTCTTCTTGGACAATTGCACAGCCAGCAGCATCTCCTGAAAATGGTGCCAGAAGCAGC
AGC
TTGGATGAATATGGTCTTAAGGCTATGGATCAGCACTCACTGTCCATGCCCAAGACCCCCTCTGCAC
TT
CCTCTGGAGCCGTGGCACTTCTCCTCCCTAGCGAGGCCAGGCTTCATAGCGCCTGCCTACTTCCCTGT
C
TTTCCCGACAGGCATCTGACTCCAGAGGTCTACCGTGTCTTTCCCGACAGGCATCTGACTCCAGAGGTC
TAC
CATGTCTTTCCTGACAGGCATCTGACTCCAGAGGTCTACCCTGATGGGAGATGTGGGCCCCTTCAAC
AT
TTAGTCCAGCAAGATAGATACCAAAACCATCCTCTGGAACCTGCTGCCAGGGAGAACTGCAGCCCTGC
C
AAGATAGCTGGAAGCACAGGATCGCTCATGAACCTGCCTCCCTACCCTGTCCACTACAAGAAGAAAATC
TGT
GCTCGTGGAGCTGCCAGTGCCAGTCTTGATGATGAAAGAAGCCCATCTCCAAAGCGAAGAAGAGATG
CC
TACTATTATTAG


Translation (307 aa):
MEEMKKNGVWIPESSQKPVKTEWNAGSVIFTYFEGDINSMVDEHFSRALRNLKRPHKCSSSSHSDNLTLK
N
GVNKTRTDTSHTDRERKVESSQTENSGELKDVPVEEKGTNKSMPPNQRHLSSWTIAQPAASPENGARSS
S
LDEYGLKAMDQHSLSMPKTPSALPLEPWHFSSLARPGFIAPAYFPVFPDRHLTPEVYRVFPDRHLTPEV
Y
HVFPDRHLTPEVYPDGRCGPLQHLVQQDRYQNHPLEPAARENCSPAKIAGSTGSLMNLPPYPVH
YKKKI
C
ARGAASASLDDE
RSPSPKRRRDAYYY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser