NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30029.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30029.1 Public Mus musculus X Gpr82 21 106 86 CCDS HistoryNCBI Gene:319200Re-query CCDS DB by CCDS ID:30029.1Re-query CCDS DB by GeneID:319200See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 30029.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000053659 ENSMUSP00000062535 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000053659Link to Ensembl Protein Viewer:ENSMUSP00000062535Re-query CCDS DB by Nucleotide ID:ENSMUST00000053659Re-query CCDS DB by Protein ID:ENSMUSP00000062535
Original member Current member EBI,WTSI OTTMUST00000041036 OTTMUSP00000018382 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041036Link to Vega Protein Viewer:OTTMUSP00000018382Re-query CCDS DB by Nucleotide ID:OTTMUST00000041036Re-query CCDS DB by Protein ID:OTTMUSP00000018382
Original member Current member NCBI NM_175669.3 NP_783600.1 Accepted alive Link to Nucleotide Sequence:NM_175669.3Link to Protein Sequence:NP_783600.1Re-query CCDS DB by Nucleotide ID:NM_175669Re-query CCDS DB by Protein ID:NP_783600Link to BLAST:NP_783600.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_783600.1 328 Q8BZR0 328 100% 0 0

Chromosomal Locations for CCDS 30029.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 13665215 13666201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (987 nt):
ATGACTAATAACTCGACATGCATTCAACCATCCGTGATTTCTACCACAGCTTTACCGGTCACTTACATCT
TT
TTGTTTATTATTGGTCTCTTTGGAAACTCACTTGCTCAGTGGGTATTTTTAACAAAAATAGGTAAGAA
A
ACATCAACACATATCTACTTGGCAAATCTTGTGACTGCAAACTTACTTGTGTGCACTGCTATGCCTTTC
ATG
GGTATATATTTCTTGAGAGGTTTTTATTGGAAATATCAATCTGTACAATGCAGACTGGTCAATTTTT
TG
GGAACTCTTTCTATGCATGTAAGTATGTTTGTCAGCCTCTTAATTTTAAGCTGGATTGCCATAAGCCG
C
TATGCTACCTTAATGAAAAAGGAGTCCAAGCAAGAGGCCACCTCATGCTACGAGAGAATGTTTTATGGT
CAC
GTACTGAAAAGATTTCGCCAGCCCAACTTTGCCAGAACAATGTGTATTTACATATGGGGAGTTGTGC
TT
GTCATAATTATTCCAGTTACCCTATACTACTCAGTAGTCGAGGCTACAGAAGAAGGACAGAGCCAGTG
C
TACAATCGGCAGATGGAACTGGGAGCCAGACCTTCTCAGATTGCGGGTCTCATTGGAACCACATTTATT
GGA
TTCTCCTTTTTAGTAGTAGTGACATCATACTATTCTCTTGTCAGCCATCTGCGAAGAGTAAGGACCT
GT
ACCTCCATTACCGAGAAAGATTTGACCTACAGATCTGTGAAAAGACACCTTTTGATCATCCAGGTCCT
C
CTAGTAGTTTGCTTTCTTCCATATAGTATTTTTAAACCCATTTTTTATGTTCTGCACCAGAGAGAAGGA
GAC
TGTCAGCAGCTGAATTATTTAATAGAAGCAAAAAACATCCTCACTTGTCTTGCATCAGCCAGAAGTA
GT
ACAGACCCCATTATATTTCTTTTATTAGATAAAACATTCAAGAAGACACTATATGGTCTCCTTACAAA
A
TCTTAA


Translation (328 aa):
MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIGKKTSTHIYLANLVTANLLVCTAMPF
M
GIYFLRGFYWKYQSVQCRLVNFLGTLSMHVSMFVSLLILSWIAISRYATLMKKESKQEATSCYERMFYG
H
VLKRFRQPNFARTMCIYIWGVVLVIIIPVTLYYSVVEATEEGQSQCYNRQMELGARPSQIAGLIGTTFI
G
FSFLVVVTSYYSLVSHLRRVRTCTSITEKDLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREG
D
CQQLNYLIEAKNILTCLASARSSTDPIIFLLLDKTFKKTLYGLLTKS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser