NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29925.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29925.1 Public Mus musculus 19 Fam160b1 21 106 86 CCDS HistoryNCBI Gene:226252Re-query CCDS DB by CCDS ID:29925.1Re-query CCDS DB by GeneID:226252See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 29925.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000036407 ENSMUSP00000048903 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036407Link to Ensembl Protein Viewer:ENSMUSP00000048903Re-query CCDS DB by Nucleotide ID:ENSMUST00000036407Re-query CCDS DB by Protein ID:ENSMUSP00000048903
Original member Current member NCBI NM_145505.4 NP_663480.3 Accepted alive Link to Nucleotide Sequence:NM_145505.4Link to Protein Sequence:NP_663480.3Re-query CCDS DB by Nucleotide ID:NM_145505Re-query CCDS DB by Protein ID:NP_663480Link to BLAST:NP_663480.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_663480.3 764 Q8CDM8-1 764 100% 0 0

Chromosomal Locations for CCDS 29925.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 57361326 57361370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57368524 57368602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57371154 57371323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57372940 57373044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57373280 57373402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57378549 57378842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57378979 57379175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57380600 57380714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57381072 57381148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57381232 57381424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57381724 57381893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57382219 57382359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57383167 57383257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57384120 57384263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57385254 57385394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57386280 57386383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 57386471 57386576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2295 nt):
ATGTTCTCCAAGCTTACGTCCATCCTGCAGCATGCCGTGGAGGCGCTCGCACCGTCTCTCCCGTTACAAG
AA
GATTTTGTTTATCACTGGAAGGCGATTACACACTACTACATAGAAACTTCAGATGATAAAGCCCCAGT
G
ACCGACACAAACATCCCATCCCACCTGGAACAGATGTTAGACATCCTGGTCCAAGAAGAAAATGAGCGG
GAA
TCTGGAGAGACAGGGCCATGCATGGAATACCTGCTCCATCACAAGATCTTGGAAACGTTATACACCT
TA
GGGAAAGCCGACTGCCCTCCAGGAATGAAGCAGCAGGTTTTGGTGTTCTATACCAAGCTTCTGGGACG
A
ATCCGGCAGCCCCTGCTTCCACACATCAACGTACACAGGCCTGTGCAGAAATTAATTCGACTCTGTGGT
GAG
GTCCTTGCAACGCCAACGGAGAATGAAGAGATCCAGTTTCTCTGCATCGTGTGTGCAAAGCTGAAAC
AG
GATCCCTACTTGGTCAACTTTTTCCTGGAGAACAAATCAAAGTCCCTGGTGTCCAGAGGAGCTCTGAG
T
GTCATCTCAGAGGATGGCCCAAAAGGTCAGGACCCGGGGTCAGGAGACGTCAGCCAGTGCCAGCAGCCC
CAG
GAGCTGTCAGGTGCTACTGGGGTGGAGCCCACGGAGTCGGAGGAAGAGCCCCCTCACCAGATGGATG
AC
CTGTCTGCAAGCCTAGATGACCTCAATGTCACCTCACTGCCGGAGGCCTCTGCCGTCCGGCCAAACCA
G
GACTACAACTTAGTGAATTCTTTGTTAAACCTGACAAGAAGTCCTGACGGCCGGATAGCTGTGAAGGCC
TGC
GAGGGCTTGATGCTCTTGGTGAGCCTACCGGAGCCTGCGGCTGCCAAGTGCCTTGCTCAGAGCACCT
GC
CTGTGCGAGCTGCTGACCGGCAGACTCACCTCCCTGTACAAGGCTCTACCTCAGTCAGTGGACCCCTT
A
GACATTGAAACCGTGGAGGCAGTTAACTGGGGGTTGGACTCATACAGCCATAAAGAAGACGCTTCGGCG
TTC
CCGGGGAAGCGGGCCTTAATTTCATTTCTTTCCTGGTTCGATTACTGTGATCAGCTCATCAAGGAGG
CA
CAAAAGACTGCTGCTGTTGCTCTCGCCAAAGCCATCCACGAAAGGTTCTTTGTTGGTGTCATGGAACC
C
CAGCTGATGCAGACCTCTGAGATGGGGATTCTGACCTCGACGGCCTTGCTGCACCGCATCGTCCGGCAA
GTG
ACCTCAGACGTCCTGCTTCAGGAAATGGTGGTCTTCATCCTCGGAGAACAGAGGGAGCCAGAAACTC
TG
TCAGAAATTAGCAGACATCCTCTAAGACATAGGTTAATCGAACATTGCGATCACATATCTGATGAGAT
C
AGCATCATGACCCTGAGGATGTTTGAGCATCTCCTACAAAAGCCCAATGAACACATCCTCTACAACCTG
GTC
TTGAGAAACCTGGAAGAAAGAAACTATACGGAGAACAAACCTTCCTGCCCGGAAGACAAGGACGTGG
TG
GAGAACGGGCTGATAGCAGGCGCCGTAGATCTGGAGGAAGATCCATTATTTACTGACATTTCACCAGA
T
AACACTCTGCCCAACCAAGAGTGGATTTGTTCACCCCGCACCAGCCCAGACCATCCCAAAAATGATGGC
AAG
ACGGAAGTGCATAAAGTGGTCAACAGTTTTCTCTGTCTAGTGCCAGATGACGCAAAGTCCTCCTACC
AC
GTGGAGGGCACCGGCTATGACACCTACCTCCGAGACGCCCACAGGCAGTTCCGAGACTACTGTGCTAT
C
TGCTCACGATGGGAGTGGCCAGGAGCCCCCAAACCACTGGAGAAGTGTGACCTAGAAGCAGCCTTCTTT
GAA
GGACATTTTTTGAAAGTTTTATTTGACAGAATGGGAAGAATTCTCGATCAGCCGTACGATGTGAATC
TG
CAGGTGACCTCAGTGCTGTCCAGACTCTCGCTGTTCCCTCACCCACACACGCACGAGTACCTCCTGGA
T
CCTTACATCAACCTGGCCTCTGGCTGCAGGTCTCTCTTCTCTGTGATTGTCAGGGTTGTTGGTGACCTC
ATG
GTTCGAATCCAGCGCATTCAAGACTTCACCCCCAAGCTTCTCCTGGTCAGAAAGCGGCTGCTTGGCT
TG
GAGCCTGAAGGCCCCATCGTTGACCACATCACACTGCTGGAGGGTGTGATTGTGTTAGAGGAGTTCTG
C
AAGGAGCTGGCGGCCATTGCCTTTGTTAAGTACCACGCTTCCGCCACGCCGTGA


Translation (764 aa):
MFSKLTSILQHAVEALAPSLPLQEDFVYHWKAITHYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENER
E
SGETGPCMEYLLHHKILETLYTLGKAD
CPPGMKQQVLVFYTKLLGRIRQPLLPHINVHRPVQKLIRLCG
E
VLATPTENEEIQFLCIVCAKLKQDPYLVNFFLE
NKSKSLVSRGALSVISEDGPKGQDPGSGDVSQCQQP
Q
ELSGATGVEPTESEEEPPHQMDDLSASLDDLNVTSLPEASAVRPNQDYNLVNSLLNLTRSP
DGRIAVKA
C
EGLMLLVSLPEPAAAKCLAQSTCLCELLTGRLTSLYKALPQSVDPLDIETVEAVNW
GLDSYSHKEDASA
F
PGKRALISFLSWFDYCDQLIKEAQK
TAAVALAKAIHERFFVGVMEPQLMQTSEMGILTSTALLHRIVRQ
V
TSDVLLQEMVVFILGEQREPETLSEISRHPLRHRLIEHCDHISDE
ISIMTLRMFEHLLQKPNEHILYNL
V
LRNLEERNYTENKPSCPEDKDVVENGLIAGA
VDLEEDPLFTDISPDNTLPNQEWICSPRTSPDHPKNDG
K
TEVHKVVN
SFLCLVPDDAKSSYHVEGTGYDTYLRDAHRQFRDYCAICSRWEWPGAPKPLEKCDLEAAFF
E
GHFLKVLFDRMGRILDQ
PYDVNLQVTSVLSRLSLFPHPHTHEYLLDPYINLASGCRSLFSVIVRVVGDL
M
VRIQRIQDFTPKLLLVRKRLLGLEPEGP
IVDHITLLEGVIVLEEFCKELAAIAFVKYHASATP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser