NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29843.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29843.1 Public Mus musculus 19 Chuk 19 105 81 CCDS HistoryNCBI Gene:12675Re-query CCDS DB by CCDS ID:29843.1Re-query CCDS DB by GeneID:12675See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29843.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000026217 ENSMUSP00000026217 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026217Link to Ensembl Protein Viewer:ENSMUSP00000026217Re-query CCDS DB by Nucleotide ID:ENSMUST00000026217Re-query CCDS DB by Protein ID:ENSMUSP00000026217
Original member Current member EBI,WTSI OTTMUST00000073744 OTTMUSP00000038220 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000073744Link to Vega Protein Viewer:OTTMUSP00000038220Re-query CCDS DB by Nucleotide ID:OTTMUST00000073744Re-query CCDS DB by Protein ID:OTTMUSP00000038220
Original member Current member NCBI NM_007700.2 NP_031726.2 Accepted alive Link to Nucleotide Sequence:NM_007700.2Link to Protein Sequence:NP_031726.2Re-query CCDS DB by Nucleotide ID:NM_007700Re-query CCDS DB by Protein ID:NP_031726Link to BLink:NP_031726.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031726.2 745 Q60680-1 745 99.8658% 0 1

Chromosomal Locations for CCDS 29843.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 44074511 44074540 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44075431 44075530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44077246 44077379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44078293 44078440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44078889 44078985 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44081946 44081995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44082586 44082695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44084417 44084478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44086908 44087059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44087916 44088039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44088675 44088777 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44090933 44091127 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44096224 44096359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44096909 44097016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44097203 44097327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44097442 44097531 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44098585 44098673 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44100150 44100219 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44101737 44101851 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44103658 44103752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 44107288 44107392 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2238 nt):
ATGGAGCGGCCCCCGGGGCTGCGGCCGGGCGCGGGCGGCCCCTGGGAGATGCGGGAACGGCTTGGCACCG
GC
GGTTTCGGGAACGTCAGTCTGTACCAGCACCGGGAACTTGATCTCAAAATAGCAATTAAGTCTTGTCG
T
TTAGAGCTAAGTTCCAAAAACAGAGAGCGATGGTGCCATGAAATCCAGATCATGAAAAAGTTGGACCAT
GCG
AATGTTGTAAAGGCCTGTGATGTCCCTGAGGAATTGAACTTTTTAATTAACGATGTGCCTCTTCTGG
CA
ATGGAGTACTGTTCTGGAGGGGACCTCCGGAAGCTACTCAACAAACCAGAAAATTGTTGTGGACTTAA
A
GAAAGCCAGATACTTTCTTTACTGAGTGACATAGGATCTGGGATCCGATATCTGCATGAAAACAAAATT
ATA
CATCGAGATCTAAAACCTGAAAATATAGTTCTTCAAGATGTTGGTGGGAAGACAATACATAAAATAA
TT
GATTTGGGTTATGCCAAAGATGTTGATCAAGGAAGTCTCTGTACATCTTTTGTGGGAACATTGCAGTA
T
TTGGCCCCAGAGCTCTTTGAAAATAAGCCGTACACAGCCACTGTGGATTATTGGAGCTTTGGGACCATG
GTG
TTTGAATGTATTGCTGGATATAGGCCTTTTTTGCATCATCTGCAGCCATTTACCTGGCATGAGAAGA
TT
AAGAAGAAAGATCCAAAGTGTATATTTGCATGTGAAGAGATGACTGGAGAAGTTCGGTTTAGTAGCCA
T
TTACCTCAGCCAAACAGCCTTTGTAGTTTAATAGTAGAGCCAATGGAAAGCTGGCTCCAATTGATGCTG
AAT
TGGGACCCACAGCAGAGAGGGGGACCTATTGATCTTACTTTGAAGCAGCCAAGATGTTTTGCATTAA
TG
GATCACATTCTCAATTTAAAGATAGTGCACATCCTAAATATGACTTCTGCAAAAATCATTTCTTTTCT
G
TTACCATGTGATGAAAGTCTTCATTCACTACAGTCTCGAATTGAGCGTGAAACAGGAATAAATACAGGT
TCT
CAGGAGCTTCTGTCAGAGACAGGGATTTCTCTGGATCCTCGGAAACCAGCCTCTCAGTGTGTTCTAG
AT
GGAGTTAGAGGCTGTGATAGCTACATGGTTTATTTGTTTGATAAAAGTAAGACTGTATATGAAGGACC
A
TTTGCATCCAGAAGTTTATCTGATTGTGTAAATTATATTGTACAAGACAGCAAAATACAACTGCCAATT
ATA
CAGCTGCGGAAAGTATGGGCTGAAGCAGTGCACTACGTATCTGGGCTAAAGGAAGACTACAGCAGGC
TC
TTCCAGGGACAAAGAGCAGCAATGTTAAGTCTTCTTAGATATAATGCTAACTTGACAAAAATGAAGAA
T
ACTTTGATCTCAGCATCACAGCAACTCAAAGCTAAATTGGAGTTTTTTCGAAAAAGCATTCAGCTTGAC
TTG
GAGAGATATAGTGAGCAGATGACTTATGGGATATCTTCAGAAAAAATGTTAAAAGCATGGAAAGAAA
TG
GAAGAAAAGGCCATTCACTATTCTGAGGTTGGTGTCATTGGTTATCTTGAGGATCAAATTATGTCTTT
G
CACACTGAAATCATGGAGCTGCAGAAGAGCCCCTATGGACGACGCCAGGGAGACTTGATGGAGTCTCTG
GAG
CAGCGTGCCATTGATCTCTATAAGCAGCTAAAGCACAGACCTCCTGATCACTTGTACAGCGACAGCA
CA
GAGATGGTGAAGATCATCGTGCACACCGTGCAGAGTCAGGACCGTGTTCTCAAGGAGCTGTTTGGTCA
C
CTGAGCAAGTTGTTGGGCTGCAAGCAGAAGATTATTGATCTACTCCCCAAGGTGGAAGTGGCCCTCAGT
AAC
ATCAAAGAAGCTGACAATACTGTCATGTTTATGCAGGGAAAGAGGCAGAAAGAAATTTGGCACCTCC
TT
AAAATTGCCTGTACACAGAGTTCTGCCCGCTCTCTTGTAGGATACAGTCTAGAAGGCACAGTAACCCC
T
CCAGTATCAGCATGGCTGCCCCCTACATTAGCAGACCGTGAACATCCTCTGACATGTGTGGTAACTCCT
CAA
GATGGAGAGACGTTAGCACAAATGATAGAAGAAAATCTGAACTGTCTTGGCCATTTAAGTACTATTA
TT
CGTGAAGCAAATGAGGACCAGAGCAGTAGTTTGATGAGTCTTGATTGGAGTTGGTTAGCAGAATGA


Translation (745 aa):
MERPPGLRPGAGGPWEMRERLGTGGFGNVSLYQHRELDLKIAIKSCRLELSSKNRERWCHEIQIMKKLDH
A
NVVKACDVPEELNFLINDVPLLAMEYCSGGDLRK
LLNKPENCCGLKESQILSLLSDIGSGIRYLHENKI
I
HRDLKPENIVLQDVGGK
TIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTM
V
FECIAGYRPFLHHLQPFT
WHEKIKKKDPKCIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMESWLQLML
N
WDPQQRGGPIDLTLKQPRCFALMDHILNLK
IVHILNMTSAKIISFLLPCDESLHSLQSRIERETGINTG
S
QELLSETGISLDPRKPASQCVLDGV
RGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
I
QLRKVWAEAVHYVSGLKEDYSRLFQGQRAA
MLSLLRYNANLTKMKNTLISASQQLKAKLEFFRKSIQLD
L
ERYSEQMTYGI
SSEKMLKAWKEMEEKAIHYSEVGVIGYLEDQIMSLHTEIMELQKSPYGRRQGDLMESL
E
QRAIDLYKQLKHRPP
DHLYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALS
N
IKEADNTVMFMQGKRQKEIWHLLKIAC
TQSSARSLVGYSLEGTVTPPVSAWLPPTLADREHPLTCVVTP
Q
D
GETLAQMIEENLNCLGHLSTIIREANEDQSSSLMSLDWSWLAE



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser