NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29611.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29611.1 Public Mus musculus 19 Stx3 21 106 86 CCDS HistoryNCBI Gene:20908Re-query CCDS DB by CCDS ID:29611.1Re-query CCDS DB by GeneID:20908See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29611.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000075304 ENSMUSP00000074776 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000075304Link to Ensembl Protein Viewer:ENSMUSP00000074776Re-query CCDS DB by Nucleotide ID:ENSMUST00000075304Re-query CCDS DB by Protein ID:ENSMUSP00000074776
Original member Current member EBI,WTSI OTTMUST00000149717 OTTMUSP00000077650 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000149717Link to Vega Protein Viewer:OTTMUSP00000077650Re-query CCDS DB by Nucleotide ID:OTTMUST00000149717Re-query CCDS DB by Protein ID:OTTMUSP00000077650
Original member NCBI NM_001025307.1 NP_001020478.1 Updated not alive Link to Nucleotide Sequence:NM_001025307.1Link to Protein Sequence:NP_001020478.1Re-query CCDS DB by Nucleotide ID:NM_001025307Re-query CCDS DB by Protein ID:NP_001020478
Current member NCBI NM_001025307.2 NP_001020478.1 Accepted alive Link to Nucleotide Sequence:NM_001025307.2Link to Protein Sequence:NP_001020478.1Re-query CCDS DB by Nucleotide ID:NM_001025307Re-query CCDS DB by Protein ID:NP_001020478Link to BLAST:NP_001020478.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001020478.1 287 Q64704-2 287 100% 0 0

Chromosomal Locations for CCDS 29611.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 11777093 11777170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11782800 11782910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11785390 11785524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11785685 11785758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11786525 11786633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11788169 11788236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11789557 11789631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11791746 11791845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11803494 11803577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 11818692 11818721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (864 nt):
ATGAAGGACCGGCTGGAGCAGCTGAAGGCCAAGCAGCTGACGCAGGATGATGACACGGACGAGGTTGAGA
TT
GCCATTGACAACACAGCCTTCATGGACGAGTTCTTCTCTGAGATCGAGGAAACACGGCTCAACATTGA
C
AAGATCTCGGAGCATGTAGAGGAAGCTAAGAAACTCTACAGTATCATTCTCTCTGCACCGATCCCAGAG
CCA
AAAACCAAAGATGACCTTGAACAGCTCACAACTGAGATCAAGAAAAGGGCCAACAACGTCCGGAACA
AG
CTGAAGAGCATGGAGAAGCACATTGAGGAAGATGAGGTTCGGTCATCTGCAGACCTTCGGATACGAAA
G
TCCCAGCACTCCGTCCTCTCCCGGAAGTTTGTGGAGGTGATGACAAAGTACAATGAGGCTCAGGTGGAC
TTC
CGTGAACGCAGCAAAGGGCGCATCCAACGGCAGCTTGAAATTACTGGCAAGAAGACAACAGATGAGG
AG
CTGGAAGAGATGTTGGAGAGTGGCAACCCAGCCATCTTCACTTCTGGGATCATTGACTCCCAGATTTC
C
AAGCAAGCCCTCAGCGAGATTGAGGGTCGGCACAAGGACATCGTAAGGCTGGAGAGCAGCATCAAGGAG
CTC
CATGACATGTTTATGGACATCGCCATGCTGGTGGAAAATCAGGGAGCCATGATTGACCGCATTGAGA
AC
AACATGGACCAGTCAGTGGGCTTTGTGGAACGGGCTGTGGCAGATACCAAAAAGGCGGTCAAGTATCA
G
AGTGAAGCCCGGAGGAAGAAGATCATGATCATGATCTGCTGTATTATCCTTGCCATCATCTTGGCTTCT
ACC
ATTGGGGGCATATTTGCCTGA


Translation (287 aa):
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPE
P
KTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD
F
RERSKGRIQRQLEI
TGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE
L
HDMFMDIAMLVENQ
GAMIDRIENNMDQSVGFVERAVADTKKAVKYQSEARRKKIMIMICCIILAIILAS
T
IGGIFA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser