NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29509.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29509.1 Public Mus musculus 19 Esrra 21 106 86 CCDS HistoryNCBI Gene:26379Re-query CCDS DB by CCDS ID:29509.1Re-query CCDS DB by GeneID:26379See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29509.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000025906 ENSMUSP00000025906 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025906Link to Ensembl Protein Viewer:ENSMUSP00000025906Re-query CCDS DB by Nucleotide ID:ENSMUST00000025906Re-query CCDS DB by Protein ID:ENSMUSP00000025906
Original member Current member EBI,WTSI OTTMUST00000056137 OTTMUSP00000026942 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000056137Link to Vega Protein Viewer:OTTMUSP00000026942Re-query CCDS DB by Nucleotide ID:OTTMUST00000056137Re-query CCDS DB by Protein ID:OTTMUSP00000026942
Original member Current member NCBI NM_007953.2 NP_031979.2 Accepted alive Link to Nucleotide Sequence:NM_007953.2Link to Protein Sequence:NP_031979.2Re-query CCDS DB by Nucleotide ID:NM_007953Re-query CCDS DB by Protein ID:NP_031979Link to BLink:NP_031979.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031979.2 422 O08580 422 100% 0 0

Chromosomal Locations for CCDS 29509.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 6911751 6912010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6912355 6912624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6912716 6912883 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6913820 6913948 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6914079 6914195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6920063 6920387 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1269 nt):
ATGTCCAGCCAGGTGGTGGGCATCGAGCCTCTCTACATCAAGGCAGAGCCAGCCAGTCCTGACAGTCCAA
AG
GGTTCCTCAGAGACTGAGACTGAACCCCCGGTGACCCTGGCCTCTGGTCCAGCTCCAGCCCGCTGCCT
T
CCAGGGCACAAGGAGGAGGAGGATGGGGAGGGGGCAGGGTCTGGTGAGCAGGGCAGTGGGAAGCTAGTG
CTC
AGCTCTCTACCCAAACGCCTCTGCCTGGTCTGTGGGGATGTGGCCTCTGGCTACCACTACGGTGTGG
CA
TCCTGTGAGGCCTGCAAAGCCTTCTTCAAGAGGACCATCCAGGGGAGCATCGAGTACAGCTGTCCGGC
C
TCCAATGAGTGTGAGATCACCAAGCGGAGACGCAAGGCCTGTCAGGCCTGCCGCTTCACCAAGTGCCTG
CGG
GTGGGCATGCTCAAGGAGGGTGTGCGTCTGGACCGTGTCCGCGGCGGACGGCAGAAGTACAAACGGC
GG
CCAGAGGTGGACCCTTTGCCTTTCCCGGGCCCCTTCCCTGCTGGACCTCTGGCAGTAGCTGGAGGACC
C
AGGAAGACAGCCCCAGTGAACGCTCTGGTGTCGCATCTGCTGGTGGTTGAACCTGAGAAGCTGTACGCC
ATG
CCTGACCCAGCAAGCCCCGATGGACACCTCCCCGCTGTGGCCACTCTCTGTGACCTTTTTGATCGAG
AG
ATAGTGGTCACCATCAGCTGGGCCAAGAGCATCCCAGGCTTCTCCTCACTGTCACTGTCTGACCAGAT
G
TCAGTACTGCAGAGTGTGTGGATGGAAGTGCTGGTGCTGGGTGTGGCCCAGCGCTCACTGCCACTGCAG
GAT
GAGCTGGCCTTTGCTGAGGACCTGGTCCTAGATGAAGAGGGGGCACGGGCAGCTGGCCTGGGGGATC
TG
GGGGCAGCCCTGCTGCAGCTGGTTCGGCGACTGCAAGCTCTTCGGCTGGAGCGGGAGGAGTACGTCCT
G
CTGAAAGCTCTGGCCCTTGCCAATTCTGACTCTGTGCACATTGAAGATGCTGAGGCTGTGGAGCAGCTG
CGC
GAAGCCCTGCATGAGGCCCTGCTGGAGTATGAAGCTGGCCGGGCTGGCCCTGGAGGGGGTGCTGAGC
GG
AGGCGTGCAGGCAGGCTGCTGCTTACGCTGCCACTCCTCCGCCAGACAGCAGGCAAAGTCCTGGCCCA
T
TTCTATGGGGTGAAGCTGGAGGGCAAGGTGCCCATGCACAAGCTGTTTTTGGAAATGCTTGAGGCCATG
ATG
GACTGA


Translation (422 aa):
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVTLASGPAPARCLPGHKEEEDGEGAGSGEQGSGKLV
L
SSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQ
GSIEYSCPASNECEITKRRRKACQACRFTKCL
R
VGMLKE
GVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAPVNALVSHLLVVEPEKLYA
M
PDPASPDGHLPAVATLCDLFDREIVVTISWAKSIP
GFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQ
D
ELAFAEDLVLDEEGARAAGLGDLGAALLQLVRRLQALRLEREEYVLLKALALANS
DSVHIEDAEAVEQL
R
EALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAM
M
D




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser