NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29049.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29049.1 Public Mus musculus 18 Gjd4 21 106 86 CCDS HistoryNCBI Gene:225152Re-query CCDS DB by CCDS ID:29049.1Re-query CCDS DB by GeneID:225152See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 29049.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041007 ENSMUSP00000035472 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041007Link to Ensembl Protein Viewer:ENSMUSP00000035472Re-query CCDS DB by Nucleotide ID:ENSMUST00000041007Re-query CCDS DB by Protein ID:ENSMUSP00000035472
Original member Current member NCBI NM_153086.5 NP_694726.2 Accepted alive Link to Nucleotide Sequence:NM_153086.5Link to Protein Sequence:NP_694726.2Re-query CCDS DB by Nucleotide ID:NM_153086Re-query CCDS DB by Protein ID:NP_694726Link to BLAST:NP_694726.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_694726.2 364 Q8BSD4 364 100% 0 0

Chromosomal Locations for CCDS 29049.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 9279982 9281012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 9282555 9282618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1095 nt):
ATGGAGAAGTTGAACTTGTTGGGATTCCTCATCATCACCTTAAACTGTAACGTGACCATCATGGGCATGA
TC
TGGCTGATCGTGGAGGTCTTGCTGAGGATGCTAGTGGTGGTCTTGGCAGGGTCACCTATCTATGAGGA
T
GAACAAGAGAGGTTTATTTGCAACACACTGCAACCAGGATGTGCCAACGTTTGCTACGACCTCTTTTCC
CCA
GTGTCACCGCTGCGATTCTGGCTAGTGCAGAGCCTGGCCTTGCTTCTGCCTTCGGTGGTCTTTGGCA
CT
TACACCCTACACCGCGGTGCGAAGCTGGCTGCAGTGGGGGGAGCCTGCAGGCCCCAGGTGCCCGACCT
G
TCTACTGCCTACCTGGTGCACCTACTGCTGCGCATGCTGCTGGAGGCCGGGCTGGCCTTCCTGCACTAC
TTT
CTCTTTGGCTTTTCTGTGCCCGCCCGCGTGTCTTGCTCGCATGTACCCTGCTCAGGGGCTGTGGACT
GC
TACGTGTCGCGGCCCACGGAGAAGTCACTCCTGATACTATTCTTTTGGGCAGTGAGTGCGCTATCCTT
C
CTGCTCAGCTTGGCTGACCTGCTTTGGATCCTGCCGAGGAGAAAGACACTGAGGACCACGCAGTGGGTG
AAT
GGAGAGGCTAGACCAGTCTGTGAAGTACCTGCACCTCCCCCTTGCCTCTTACAAAACCCCCAGGGCT
AT
CTTAGCCAAGGTCAGGTGGACCAAGAGGACAGACAGGAGGAACAAGTTGTGCCTGAGTTCCCCTGCAT
G
TGGACAGCAGGGCAGAGTGACAACAGCAATGTTGGTCAGGCCTGTGTGTCGGGGCTGCTGGAACATTCA
GAC
CAAGATGCTAGTGAGGCCACTTCCTCAGCTGGTGACAGGCTAACAGTGGCTCACACAGCACATGAGC
TC
AGATTCCACAGAGAGACTTCACTGGACCTGGGGGGCAAAAACACCCAGGCAGATGAACTCTCCTTGGC
T
ACCCAGAGCCACCTGGCCAGACACAGTTCAGCCAGCAAGCCTCAAGCTCCATGCCGGCTGACCACCTCA
GGC
AGTGCTCCCCATTTGAGAACCAAAAAATCTGAGTGGGTGTGA


Translation (364 aa):
MEKLNLLGFLIITLNCNVTIMGMIWLIVEVLLRMLVVVLAGSPIYEDEQERFICNTLQPGCANVCYDLFS
P
VSPLRFWLVQSLALLLPSVVFGTYTLHRGAKLAAVGGACRPQVPDLSTAYLVHLLLRMLLEAGLAFLHY
F
LFGFSVPARVSCSHVPCSGAVDCYVSRPTEKSLLILFFWAVSALSFLLSLADLLWILPRRKTLRTTQWV
N
GEARPVCEVPAPPPCLLQNPQGYLSQGQVDQEDRQEEQVVPEFPCMWTAGQSDNSNVGQACVSGLLEHS
D
QDASEATSSAGDRLTVAHTAHELRFHRETSLDLGGKNTQADELSLATQSHLARHSSASKPQAPCRLTTS
G
SAPHLRTKKSEWV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser