NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28967.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28967.1 Public Mus musculus 17 Xdh 21 106 86 CCDS HistoryNCBI Gene:22436Re-query CCDS DB by CCDS ID:28967.1Re-query CCDS DB by GeneID:22436See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 28967.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024866 ENSMUSP00000024866 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024866Link to Ensembl Protein Viewer:ENSMUSP00000024866Re-query CCDS DB by Nucleotide ID:ENSMUST00000024866Re-query CCDS DB by Protein ID:ENSMUSP00000024866
Original member Current member NCBI NM_011723.3 NP_035853.2 Accepted alive Link to Nucleotide Sequence:NM_011723.3Link to Protein Sequence:NP_035853.2Re-query CCDS DB by Nucleotide ID:NM_011723Re-query CCDS DB by Protein ID:NP_035853Link to BLink:NP_035853.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035853.2 1335 Q00519 1335 100% 0 0

Chromosomal Locations for CCDS 28967.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 73884433 73884483 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73886343 73886519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73891111 73891299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73892719 73892784 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73893600 73893714 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73895744 73895796 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73897007 73897081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73897682 73897810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73898316 73898411 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73898961 73899042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73900262 73900407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73900532 73900723 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73906010 73906096 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73906204 73906291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73906695 73906828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73907621 73907745 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73909247 73909343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73910166 73910285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73912417 73912540 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73913871 73914040 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73915677 73915760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73916788 73916962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73918373 73918557 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73920393 73920502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73921267 73921360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73922413 73922564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73923043 73923135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73924915 73925056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73926174 73926260 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73926548 73926616 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73934802 73934863 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73935872 73935998 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73939756 73939861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73941042 73941138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73943847 73943904 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 73950078 73950128 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4008 nt):
ATGACGAGGACAACGGTAGATGAGTTGGTCTTCTTTGTGAATGGCAAAAAGGTGGTGGAGAAAAATGCAG
AC
CCTGAAACAACACTTCTGGTCTACCTTAGAAGAAAGTTGGGGCTGTGCGGGACCAAGCTTGGCTGTGG
A
GAAGGTGGCTGTGGGGCATGCACCGTGATGATCTCCAAGTATGACCGCCTTCAGAACAAGATCGTTCAT
TTT
TCCGTCAATGCCTGCTTGACCCCCATCTGCTCCTTGCATCATGTTGCTGTGACAACTGTGGAAGGCA
TA
GGAAACACCAAGAAGCTGCATCCTGTCCAGGAGAGAATTGCCAAAAGCCATGGTTCCCAGTGTGGGTT
C
TGTACCCCTGGTATTGTCATGAGTATGTACACACTGCTCCGAAACAAGCCTGAGCCTACTGTCGAGGAG
ATC
GAGAATGCCTTCCAAGGAAACCTCTGCCGCTGTACAGGCTATAGACCCATCCTCCAGGGATTCCGGA
CC
TTTGCCAAGGATGGTGGGTGCTGTGGAGGAAGTGGAAACAACCCAAACTGCTGCATGAGCCAAACAAA
G
GACCAGACGATTGCTCCCTCATCTTCTTTATTCAACCCGGAGGATTTCAAACCTTTAGATCCCACCCAA
GAG
CCCATCTTTCCCCCAGAGTTGCTGAGGCTGAAAGACACTCCCCGGAAGACGTTGCGTTTTGAAGGGG
AA
CGTGTGACCTGGATCCAGGTTTCAACCATGGAGGAACTGCTTGACCTCAAAGCCCAGCACCCTGATGC
C
AAGCTGGTGGTGGGAAACACAGAGATAGGCATTGAAATGAAATTTAAAAATATGCTATTTCCTCTGATC
ATC
TGCCCAGCCTGGATCCTTGAACTGACCTCAGTGGCACATGGGCCTGAGGGAATCTCCTTTGGAGCCG
CT
TGCCCCCTTAGCTTGGTGGAAAGTGTCCTGGCGGACGCGATTGCTACACTTCCAGAGCAGAGGACAGA
G
GTGTTCAGAGGCGTGATGGAGCAGCTGCGCTGGTTTGCTGGCAAGCAGGTCAAGTCCGTGGCGTCCATT
GGC
GGGAACATCATCACCGCGAGCCCCATCTCTGACCTCAACCCTGTGCTCATGGCCAGTCGAGCCAAGC
TG
ACCCTCGCATCTAGAGGTACCAAGAGAACGGTCTGGATGGACCATACCTTCTTCCCTGGCTATAGAAG
G
ACTCTGCTCAGTCCAGAGGAGATATTGGTGTCCATTGTGATCCCCTACAGCAGGAAGGGTGAGTTTTTC
TCA
GCCTTCAAGCAGGCCTCCAGGAGAGAAGATGACATTGCCAAGGTGACCAGTGGCATGAGAGTCCTGT
TC
AAGCCAGGGACCACTGAAGTGCAGGAACTGTCCCTTTGCTTTGGAGGGATGGCTGACAGAACTGTCTC
A
GCCCTCAAGACCACTCCGAAGCAGCTGTCCAAGTCCTGGAATGAGGAGTTGCTGCAGGATGTGTGTGCT
GGC
TTGGCAGAGGAGCTGCACCTGGCCCCCGACGCCCCTGGTGGGATGGTGGAATTCCGGCGCACCCTCA
CC
CTCAGCTTCTTCTTCAAGTTCTACCTGACAGTGCTTCAGAAGCTGGGCAGAGCGGACCTTGAGGGTAT
G
TGTGGTAAACTGGACCCCACCTTTGCCAGCGCCACCCTGCTCTTTCAGAAGGATCCTCCAGCTAACGTC
CAG
CTTTTCCAAGAGGTGCCCAAGGGTCAGTCTGAGGAGGACATGGTGGGCAGGCCCATGCCTCACCTGG
CA
GCAGACATGCAGGCATCCGGGGAGGCTGTGTACTGTGATGACATTCCCCGCTATGAGAATGAGCTGTC
C
CTCAGGCTGGTCACCAGCACGCGGGCCCATGCTAAAATCATGTCCATCGACACTTCAGAAGCCAAGAAG
GTG
CCAGGGTTTGTTTGTTTCCTCACCTCAGAGGATGTCCCTGGTAGTAACATAACTGGCATTTTCAATG
AT
GAAACTGTCTTTGCGAAGGATGAGGTTACTTGTGTTGGGCACATCATTGGTGCTGTGGTCGCTGACAC
C
CCAGAACATGCACACAGAGCCGCTAGAGGGGTGAAAATCACCTATGAAGACCTTCCAGCCATTATCACA
ATC
CAGGATGCTATAAAGAACAACTCCTTTTATGGCCCCGAGGTAAAAATCGAGAAAGGAGATCTCAAGA
AA
GGCTTTTCTGAAGCTGACAATGTTGTCTCAGGAGAATTATATATTGGTGGCCAGGAGCACTTCTATCT
G
GAGACCCACTGCACCATTGCCGTGCCGAAAGGCGAGGCAGGCGAGATGGAGCTCTTCGTGAGCACACAG
AAC
ACCATGAAAACCCAGAGCTTTATTGCAAAGATGTTGGGTGTTCCAGACAACAGAATTGTAGTCCGAG
TG
AAAAGAATGGGTGGAGGCTTTGGAGGGAAGGAGACCCGGAGCACTCTGATATCCACAGCAGTGGCCTT
G
GCTGCATACAAGACAGGCCGCCCTGTACGTTGCATGCTGGACCGAGACGAGGACATGCTCATAACTGGT
GGC
AGACATCCCTTCCTGGCTAAATACAAGGTGGGCTTCATGAAGACTGGGACTATAGTGGCACTGGAGG
TG
GCTCACTTCAGCAATGGCGGGAACAGTGAGGATCTCTCTCGGAGTATAATGGAAAGAGCTGTATTCCA
C
ATGGACAACGCCTATAAGATCCCCAACATTCGCGGCACCGGGAGGATTTGTAAGACTAATCTGCCCTCT
AAC
ACAGCCTTCAGAGGCTTTGGGGGTCCTCAGGGGATGCTAATCGCAGAATACTGGATGAGTGAGGTCG
CT
GTCACCTGTGGGCTGCCTGCAGAGGAGGTACGGAGGAAAAACATGTACAAAGAAGGGGACCTGACTCA
C
TTCAACCAGAAGCTGGAGGGGTTCACCTTGCCCAGGTGCTGGGATGAGTGCATAGCGAGCTCCCAGTAT
CAG
GCTCGCAAGATGGAAGTGGAGAAATTCAACAGGGAGAACTGTTGGAAAAAGAGAGGGCTGTGTATAA
TC
CCGACTAAGTTTGGAATAAGCTTCACACTTTCTTTTCTGAACCAGGGGGGTGCCTTGGTCCACGTGTA
C
ACGGATGGGTCGGTGCTGCTGACACATGGAGGTACTGAGATGGGTCAAGGCCTTCACACCAAGATGGTT
CAG
GTGGCCAGCAGAGCTCTGAAAATCCCCACTTCCAAGATCCATATAACGGAGACAAGCACTAACACTG
TC
CCTAACACCTCTCCCACGGCTGCCTCTGCCAGCGCTGACCTCAATGGCCAGGCCATTTATGAAGCCTG
T
CAGACCATACTGAAAAGACTGGAGCCCTTCAAGAAAAAGAATCCCTCAGGCTCCTGGGAGAGCTGGGTC
ATG
GATGCCTACACTAGTGCAGTGAGCTTGTCTGCTACTGGATTTTATAAGACACCCAACCTTGGTTACA
GC
TTTGAGACAAACTCTGGGAACCCCTTCCACTACTTCAGTTATGGGGTGGCTTGCTCAGAAGTAGAAAT
T
GACTGCTTAACAGGGGACCATAAGAATCTCCGTACAGATATCGTCATGGATGTTGGTTCCAGCTTGAAT
CCT
GCCATTGATATCGGACAGGTAGAAGGGGCATTTGTCCAGGGTCTTGGTCTTTTCACCATGGAGGAGC
TG
CACTACTCTCCCGAGGGGAGCCTGCACACTCGTGGCCCCAGTACCTACAAGATCCCTGCATTTGGCAG
C
ATCCCCATTGAGTTCAGAGTATCCCTGCTCCGCGACTGCCCCAACAAGAGGGCCATCTATGCATCCAAG
GCT
GTCGGCGAGCCACCTCTTTTCCTGGCTTCTTCGATCTTCTTTGCCATCAAAGATGCCATCCGCGCAG
CT
CGAGCTCAGCACGGAGACAGTAACGCCAAACAGCTCTTCCAGCTAGACAGCCCCGCCACTCCGGAGAA
G
ATCCGAAACGCTTGTGTGGATCAGTTCACCACCCTGTGTGCCACTGGAACACCAGAAAACTGTAAATCC
TGG
TCCGTGAGGATCTGA


Translation (1335 aa):
MTRTTVDELVFFVNGKKVVEKNADPETTLLVYLRRKLGLCGTKLGCGEGGCGACTVMISKYDRLQNKIVH
F
SVNACLTPICSLHHVAVTTVEGIGNTKKLHPVQ
ERIAKSHGSQCGFCTPGIVMSMYTLLRNKPEPTVEE
I
ENAFQ
GNLCRCTGYRPILQGFRTFAKDGGCCGGSGNNPNCCMSQTKDQTIAPSSSLFNPEDFKPLDPTQ
E
PIFPPELL
RLKDTPRKTLRFEGERVTWIQVSTMEELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPLI
I
CPAWILELTSVAHGPE
GISFGAACPLSLVESVLADAIATLPEQRTEVFRGVMEQLRWFAGKQVKSVASI
G
GNIITASPISDLNPVLMASRAKLTLASR
GTKRTVWMDHTFFPGYRRTLLSPEEILVSIVIPYSRKGEFF
S
AFKQASRREDDIAKVTSGMRVLFKPGTTEVQELSLCFGGMADRTVSALKTTPKQLS
KSWNEELLQDVCA
G
LAEELHLAPDAPGGMVEFRRTLTLSFFFKFYLTVLQKLGRADLEG
MCGKLDPTFASATLLFQKDPPANV
Q
LFQ
EVPKGQSEEDMVGRPMPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAKIMSIDTSEAKK
V
PGFVCFLTSEDVPGSNITGIFNDETVFAKDE
VTCVGHIIGAVVADTPEHAHRAARGVKITYEDLPAIIT
I
Q
DAIKNNSFYGPEVKIEKGDLKKGFSEADNVVSGELYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQ
N
TMKTQ
SFIAKMLGVPDNRIVVRVKRMGGGFGGKETRSTLISTAVALAAYKTGRPVRCMLDRDEDMLITG
G
RHPFLAKYK
VGFMKTGTIVALEVAHFSNGGNSEDLSRSIMERAVFHMDNAYKIPNIRGTGRICKTNLPS
N
TAFRGFGGPQGMLIAEYWMSEVAVTCGLPAEE
VRRKNMYKEGDLTHFNQKLEGFTLPRCWDECIASSQY
Q
ARKMEVEKFN
RENCWKKRGLCIIPTKFGISFTLSFLNQGGALVHVYTDGSVLLTHGGTEMGQGLHTKMV
Q
VASRALKIPTSKIHITETSTNTVPNTSPTAASASADLNGQAIYEACQTILKRLEPFKKKNPSGSWESWV
M
DAYTSAVSLSATGFY
KTPNLGYSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLN
P
AIDIGQ
VEGAFVQGLGLFTMEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKRAIYASK
A
VGEPPLFLASSIFFAIKDAIRAARAQHGDSNAKQLFQLDSPATPEKIRNACVDQFTTL
CATGTPENCKS
W
SVRI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser