NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28913.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28913.1 Public Mus musculus 17 Nrtn 21 106 86 CCDS HistoryNCBI Gene:18188Re-query CCDS DB by CCDS ID:28913.1Re-query CCDS DB by GeneID:18188See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 28913.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044752 ENSMUSP00000046512 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044752Link to Ensembl Protein Viewer:ENSMUSP00000046512Re-query CCDS DB by Nucleotide ID:ENSMUST00000044752Re-query CCDS DB by Protein ID:ENSMUSP00000046512
Original member NCBI NM_008738.2 NP_032764.1 Updated not alive Link to Nucleotide Sequence:NM_008738.2Link to Protein Sequence:NP_032764.1Re-query CCDS DB by Nucleotide ID:NM_008738Re-query CCDS DB by Protein ID:NP_032764
Current member NCBI NM_008738.3 NP_032764.1 Accepted alive Link to Nucleotide Sequence:NM_008738.3Link to Protein Sequence:NP_032764.1Re-query CCDS DB by Nucleotide ID:NM_008738Re-query CCDS DB by Protein ID:NP_032764Link to BLAST:NP_032764.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032764.1 195 P97463 195 100% 0 0

Chromosomal Locations for CCDS 28913.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 56751412 56751830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 56752309 56752477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (588 nt):
ATGAGGCGCTGGAAGGCAGCGGCCCTGGTGTCGCTCATCTGCAGCTCCCTGCTATCTGTCTGGATGTGCC
AG
GAGGGTCTGCTCTTGGGCCACCGCCTGGGACCCGCGCTTGCCCCGCTACGACGCCCTCCACGCACCCT
G
GACGCCCGCATCGCCCGCCTGGCCCAGTATCGCGCTCTGCTCCAGGGCGCCCCCGACGCGGTGGAGCTT
CGA
GAACTTTCTCCCTGGGCTGCCCGCATCCCGGGACCGCGCCGTCGAGCGGGTCCCCGGCGTCGGCGGG
CG
CGGCCGGGGGCTCGGCCTTGTGGGCTGCGCGAGCTCGAGGTGCGCGTGAGCGAGCTGGGCCTGGGCTA
C
ACGTCGGATGAGACCGTGCTGTTCCGCTACTGCGCAGGCGCGTGCGAGGCGGCCATCCGCATCTACGAC
CTG
GGCCTTCGGCGCCTGCGCCAGCGGAGGCGCGTGCGCAGAGAGCGGGCGCGGGCGCACCCGTGTTGTC
GC
CCGACGGCCTATGAGGACGAGGTGTCCTTCCTGGACGTGCACAGCCGCTACCACACGCTGCAAGAGCT
G
TCGGCGCGGGAGTGCGCGTGCGTGTGA


Translation (195 aa):
MRRWKAAALVSLICSSLLSVWMCQEGLLLGHRLGPALAPLRRPPRTLDARIARLAQYRALLQGAPDAVEL
R
ELSPWAARIPGPRRRAGPRRRRARPGARPCGLRELEVRVSELGLGYTSDETVLFRYCAGACEAAIRIYD
L
GLRRLRQRRRVRRERARAHPCCRPTAYEDEVSFLDVHSRYHTLQELSARECACV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser