NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28379.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28379.1 Public Mus musculus 17 Tagap 21 106 86 CCDS HistoryNCBI Gene:72536Re-query CCDS DB by CCDS ID:28379.1Re-query CCDS DB by GeneID:72536See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28379.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000036370 ENSMUSP00000047431 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036370Link to Ensembl Protein Viewer:ENSMUSP00000047431Re-query CCDS DB by Nucleotide ID:ENSMUST00000036370Re-query CCDS DB by Protein ID:ENSMUSP00000047431
Original member Current member EBI,WTSI OTTMUST00000088332 OTTMUSP00000048122 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000088332Link to Vega Protein Viewer:OTTMUSP00000048122Re-query CCDS DB by Nucleotide ID:OTTMUST00000088332Re-query CCDS DB by Protein ID:OTTMUSP00000048122
Original member Current member NCBI NM_145968.2 NP_666080.1 Accepted alive Link to Nucleotide Sequence:NM_145968.2Link to Protein Sequence:NP_666080.1Re-query CCDS DB by Nucleotide ID:NM_145968Re-query CCDS DB by Protein ID:NP_666080Link to BLink:NP_666080.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_666080.1 714 B2RWW0 714 100% 0 0

Chromosomal Locations for CCDS 28379.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 7926910 7926936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7927026 7927079 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7927367 7927433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7928608 7928774 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7929284 7929445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7929869 7929978 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7931372 7931567 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7932131 7932245 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 7932883 7934129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2145 nt):
ATGAAGCTGATAAGCAGTCTCGATGGTTCAAAAACACTTAATGCTAACAACATGGAGACATTAATTGAAT
GT
CAGTCAGAGGGTGATATCAAAGTGCCTCCCCTGCTGACATCATGTGAGAGTGAAGACAGCATTTGCCA
G
CTAACTGAAATTAAGAAGAGAAAGAAAGTGCTGTCCTGGCCATCTCTCATGAGAAAGCTCTCTCCTTCA
TCC
GACTTCTCTGGGTCATTGGAACCAGAGCTGAAAGTGTCGCTGTTTGACCAACCCTTGTCGATCATCT
GT
GGGGAGAACGACACACTTCCCAGACCCATCCAGGACATCCTCACCATCCTCTGCCTTAAAGGTCCTTC
A
ACGGAAGGGATATTCAGGAAAGCTGCCAGCGAGAAAGCCCGCAAGGAGCTGAAGGAGGGGCTTAACTGT
GGG
GTCTCCGTGAATCTGAAGCAGCTCCCTGTGCACCTCCTAGCTGTGGTCTTCAAGGACTTCCTCCGAG
GG
ATACCCCTGAAGCTACTCTCCTGTGATCTCTTTGAGGACTGGATGGGCGCCCTGGAGAAGCCCACCGA
G
GAGGACAGAATCGAGGCCCTGAAGCAGGTTGCTGGTGGCCTCCCCCGGCCCAACCTTCTCCTGCTCAGG
CAC
TTGCTCTACGTGCTCCACCTCATCAGCAAGAACGCTGAGGTCAACAAGATGGACTCCAGCAACCTCG
CC
ATCTGCATCGGGCCTAACATGCTCACTCTGAAGAACGACCAGAGCCTGTCCTTCCAGGCCCAGAAGGA
C
CTGAACAATAAGGTTAAGATCTTGGTGGAATTCCTCATCGACAACTGCTTTGAGATATTTGGGGAGAAC
ATT
CGGACGCGTTCCCGCATCACTTCTGACGACTCCCTGGAACACACTGACAGTTCAGACGTGTCAACTC
TG
CAGAATGACTCGGCCTATGACAGCAATGACCCAGATGTGGAGCCCACAAGTGGCGCAGCCTCTCCCAA
C
AGGCAACTGGAGGGTCCCACTCCCACAATGGCTGGTCTGGATACCCGGGGCCAACGGGACACCTGTGAG
TCA
AGCTCAGAGTCCAGCGTTAGCATGGTAGTCAGGCTGAAAAGCTCCATTGTCCAACAAGACAGGCGGT
TC
TCTGAACCCAACATGTCACCCTCACGAGAGTGCCTCGTGGGCCCAACATCCAAGCAAAAGCTAGCAAG
G
AGTGAGGACAGCTTCACTCTGTCCCAGGACGCCTCCTGTTCTGAAGGCGATGAAGCTGAAGATCCCTTT
ACA
GAGGAAGTCTTCCCAGCAGTGGACAGCAAACCCAAGAGACCTGTGGATTTGAAAATAAAGAATTGGA
CC
CAAGGTTTAGCATCTCCACAGGGACACATAACCAAAGCTTTCTCCAGATCCTCCCCAGGCGAATCTTT
G
GGCAGCTCACCTGTGCCTTCTCCATCCTGCCCCAAGAGAAACTTCTTCACCAGACACCAGAGTTTCACA
ACA
AAGACAGACAAAACCAAACCCCAGAGAGAAATTAGAAAGCACTCCATGTCGTTTTCCTTTGCGTCTC
AC
AAGAAAGTGCTGCCCCGAACCTCCAGCATTGGGTCTGAGAAATCCAAAGACTTTTCTAGAGACCAACT
C
CAGAAGGACTTGAGGAAAGAGAGCCAACTTTCTGGCAGAATCGTCCAGGAAAATGAGTCAGAAATCCAA
AGC
CAAACATCTCTGGGCTTCAGCTTGTCTGGCACCTGGGCCCTCTCAGTCGACAACACGTTCCAGTTAG
TG
GATATGAGGAAACCAGGAAGCCCACCATCTTACGAAGAGGCCATTTATTACCAGACATCAGGACTCAC
A
GCCTACGGTGGCCAGACAGTTGGGAGTATGAGGTCAAGAATGTTCAAGCCAAGCACAGCAGTGCCCCCT
GTG
CCTTCTCACCATGGAGGTGACCTCAGTGAAGGGACACCTGGTGGACACAGATTGTCTTCTGTGACTG
AG
CACTGGACACACAGTCAGACTGTCCATGTCTCTATAGAAACTCAGGGGAGATCTGAGCTACACCAGTT
G
AGGACAGTGTCCGAGTCCATGCAGAAGGCTAAGCTGGACTGTCTTGGGCCACAACACAGCCACTTAGTC
TTT
GAGGCTGACCAACTCTGCTGTGCTAGAGAATCCTACATTTAA


Translation (714 aa):
MKLISSLDGSKTLNANNMETLIECQSEGDIKVPPLLTSCESEDSICQLTEIKKRKKVLSWPSLMRKLSPS
S
DFSGSLEPELKVSLFDQPLSIICGENDTLPRPIQ
DILTILCLKGPSTEGIFRKAASEKARKELKEGLNC
G
VSVNLKQLPVHLLAVVFK
DFLRGIPLKLLSCDLFEDWMGALEKPTEEDRIEALKQVAGGLPRPNLLLLR
H
LLYVLHLISKNAEVNKMDSSNLAICIGPNMLTLKNDQSLSFQAQKDLNNK
VKILVEFLIDNCFEIFGEN
I
RTRSRITSDDSLEHTDSS
DVSTLQNDSAYDSNDPDVEPTSGAASPNRQLEGPTPTMAGLDTRGQRDTCE
S
SSESSVSMVVRLKSSIVQQDRRFSEPNMSPSRECLVGPTSKQKLARSEDSFTLSQDASCSEGDEAEDPF
T
EEVFPAVDSKPKRPVDLKIKNWTQGLASPQGHITKAFSRSSPGESLGSSPVPSPSCPKRNFFTRHQSFT
T
KTDKTKPQREIRKHSMSFSFASHKKVLPRTSSIGSEKSKDFSRDQLQKDLRKESQLSGRIVQENESEIQ
S
QTSLGFSLSGTWALSVDNTFQLVDMRKPGSPPSYEEAIYYQTSGLTAYGGQTVGSMRSRMFKPSTAVPP
V
PSHHGGDLSEGTPGGHRLSSVTEHWTHSQTVHVSIETQGRSELHQLRTVSESMQKAKLDCLGPQHSHLV
F
EADQLCCARESYI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser