NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28326.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28326.1 Public Mus musculus 16 Ifnar1 21 106 86 CCDS HistoryNCBI Gene:15975Re-query CCDS DB by CCDS ID:28326.1Re-query CCDS DB by GeneID:15975See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28326.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023689 ENSMUSP00000023689 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023689Link to Ensembl Protein Viewer:ENSMUSP00000023689Re-query CCDS DB by Nucleotide ID:ENSMUST00000023689Re-query CCDS DB by Protein ID:ENSMUSP00000023689
Original member Current member EBI,WTSI ENSMUST00000117748 ENSMUSP00000112670 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000117748Link to Ensembl Protein Viewer:ENSMUSP00000112670Re-query CCDS DB by Nucleotide ID:ENSMUST00000117748Re-query CCDS DB by Protein ID:ENSMUSP00000112670
Original member Current member EBI,WTSI ENSMUST00000123196 ENSMUSP00000119160 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000123196Link to Ensembl Protein Viewer:ENSMUSP00000119160Re-query CCDS DB by Nucleotide ID:ENSMUST00000123196Re-query CCDS DB by Protein ID:ENSMUSP00000119160
Original member Current member EBI,WTSI OTTMUST00000067225 OTTMUSP00000033796 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067225Link to Vega Protein Viewer:OTTMUSP00000033796Re-query CCDS DB by Nucleotide ID:OTTMUST00000067225Re-query CCDS DB by Protein ID:OTTMUSP00000033796
Original member Current member EBI,WTSI OTTMUST00000067227 OTTMUSP00000033797 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067227Link to Vega Protein Viewer:OTTMUSP00000033797Re-query CCDS DB by Nucleotide ID:OTTMUST00000067227Re-query CCDS DB by Protein ID:OTTMUSP00000033797
Original member Current member EBI,WTSI OTTMUST00000067228 OTTMUSP00000033798 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067228Link to Vega Protein Viewer:OTTMUSP00000033798Re-query CCDS DB by Nucleotide ID:OTTMUST00000067228Re-query CCDS DB by Protein ID:OTTMUSP00000033798
Original member Current member NCBI NM_010508.2 NP_034638.2 Accepted alive Link to Nucleotide Sequence:NM_010508.2Link to Protein Sequence:NP_034638.2Re-query CCDS DB by Nucleotide ID:NM_010508Re-query CCDS DB by Protein ID:NP_034638Link to BLAST:NP_034638.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034638.2 590 P33896 590 100% 0 0

Chromosomal Locations for CCDS 28326.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 91485344 91485416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91489696 91489819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91492631 91492809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91495149 91495303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91495391 91495532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91496144 91496261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91499404 91499603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91499856 91499989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91501622 91501769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91503385 91503527 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91505055 91505411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1773 nt):
ATGCTCGCTGTCGTGGGCGCGGCGGCCCTGGTGCTGGTGGCCGGGGCGCCTTGGGTGCTACCCTCAGCTG
CA
GGTGGAGAAAATCTGAAACCTCCTGAGAATATAGACGTCTACATTATAGATGACAACTACACCCTAAA
G
TGGAGCAGCCACGGAGAGTCAATGGGCAGTGTGACCTTTTCAGCAGAATATCGAACAAAAGACGAGGCG
AAG
TGGTTAAAAGTGCCTGAATGTCAACATACTACAACGACCAAGTGTGAATTCTCTTTACTGGACACAA
AT
GTGTATATCAAAACACAGTTTCGTGTCAGAGCAGAGGAAGGGAACAGCACATCTTCGTGGAATGAGGT
T
GATCCGTTTATTCCATTCTACACAGCTCACATGAGCCCCCCAGAAGTACGTTTAGAAGCTGAAGATAAA
GCC
ATACTAGTCCACATCTCTCCTCCCGGACAAGACGGGAACATGTGGGCACTGGAGAAACCTTCCTTCA
GT
TACACCATACGAATCTGGCAGAAGTCTTCCAGTGACAAAAAAACTATTAACTCTACGTATTATGTAGA
A
AAGATACCAGAACTCTTGCCAGAGACTACTTACTGTTTAGAAGTTAAAGCAATACATCCGTCACTTAAG
AAA
CACAGCAATTACAGCACTGTGCAGTGTATAAGCACCACAGTGGCAAATAAAATGCCTGTGCCAGGAA
AT
CTCCAAGTGGATGCCCAAGGCAAGAGCTATGTCCTGAAATGGGACTACATTGCGTCTGCAGACGTGCT
C
TTCAGGGCACAGTGGCTTCCTGGCTATTCAAAAAGCAGTTCTGGAAGCCGTTCAGATAAATGGAAACCA
ATA
CCAACCTGTGCAAATGTCCAGACTACGCACTGTGTCTTTTCTCAAGATACTGTCTACACAGGAACGT
TC
TTTCTCCATGTACAAGCCTCAGAGGGAAATCACACATCCTTTTGGTCTGAAGAGAAGTTTATTGATTC
T
CAAAAACACATTCTCCCTCCTCCTCCGGTCATTACTGTCACCGCCATGAGTGACACCTTGCTTGTTTAT
GTC
AACTGTCAGGACAGCACATGTGATGGACTCAATTACGAAATCATCTTTTGGGAAAACACTTCCAATA
CT
AAGATAAGCATGGAGAAGGATGGCCCAGAGTTCACCCTCAAGAACCTGCAGCCGCTGACTGTGTACTG
T
GTCCAGGCCAGAGTGCTCTTCAGGGCCCTGCTGAATAAGACCAGCAACTTCAGTGAAAAGCTGTGTGAG
AAA
ACACGTCCAGGAAGTTTTTCCACGATCTGGATTATAACTGGATTAGGTGTTGTGTTCTTCTCTGTCA
TG
GTCCTTTATGCTTTGAGGAGCGTCTGGAAATACCTGTGTCATGTGTGCTTCCCACCACTCAAGCCTCC
C
CGCAGTATTGATGAGTTTTTCTCTGAGCCGCCTTCAAAAAACCTTGTACTTCTGACGGCTGAGGAGCAC
ACG
GAAAGATGCTTCATCATTGAGAATACAGACACGGTCGCTGTAGAAGTAAAGCACGCGCCTGAGGAGG
AC
CTCAGGAAGTACAGCTCACAGACCAGCCAGGACTCGGGCAACTATTCCAACGAAGAGGAGGAGAGTGT
G
GGCACCGAGAGCGGCCAAGCTGTGCTCTCCAAAGCTCCCTGCGGGGGGCCATGCAGCGTGCCTAGCCCT
CCT
GGGACCTTGGAAGACGGGACCTGCTTCCTGGGAAATGAAAAATATCTTCAGAGCCCAGCCCTGAGGA
CA
GAGCCAGCTCTTCTCTGCTGA


Translation (590 aa):
MLAVVGAAALVLVAGAPWVLPSAAGGENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTFSAEYRTKDEA
K
WLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPFIPFYT
AHMSPPEVRLEAEDK
A
ILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDK
KTINSTYYVEKIPELLPETTYCLEVKAIHPSLK
K
HSNYSTVQCISTT
VANKMPVPGNLQVDAQGKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKP
I
PTCANVQTTHCVFSQDTVYTGTFFLHVQASEGNHTSFWSEEKFIDSQKH
ILPPPPVITVTAMSDTLLVY
V
NCQDSTCDGLNYEIIFWENTSNTK
ISMEKDGPEFTLKNLQPLTVYCVQARVLFRALLNKTSNFSEKLCE
K
TRP
GSFSTIWIITGLGVVFFSVMVLYALRSVWKYLCHVCFPPLKPPRSIDEFFSEPPSKNLVLLTAEEH
T
ERCFIIENTDTVAVEVKHAPEEDLRKYSSQTSQDSGNYSNEEEESVGTESGQAVLSKAPCGGPCSVPSP
P
GTLEDGTCFLGNEKYLQSPALRTEPALLC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser