NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28325.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28325.1 Public Mus musculus 16 Ifnar2 21 106 86 CCDS HistoryNCBI Gene:15976Re-query CCDS DB by CCDS ID:28325.1Re-query CCDS DB by GeneID:15976See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28325.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023693 ENSMUSP00000023693 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023693Link to Ensembl Protein Viewer:ENSMUSP00000023693Re-query CCDS DB by Nucleotide ID:ENSMUST00000023693Re-query CCDS DB by Protein ID:ENSMUSP00000023693
Original member Current member EBI,WTSI OTTMUST00000067197 OTTMUSP00000033776 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067197Link to Vega Protein Viewer:OTTMUSP00000033776Re-query CCDS DB by Nucleotide ID:OTTMUST00000067197Re-query CCDS DB by Protein ID:OTTMUSP00000033776
Original member Current member NCBI NM_010509.2 NP_034639.2 Accepted alive Link to Nucleotide Sequence:NM_010509.2Link to Protein Sequence:NP_034639.2Re-query CCDS DB by Nucleotide ID:NM_010509Re-query CCDS DB by Protein ID:NP_034639Link to BLAST:NP_034639.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034639.2 513 O35664-1 513 100% 0 0

Chromosomal Locations for CCDS 28325.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 91383899 91383953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91384983 91385024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91385942 91386065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91387944 91388116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91391721 91391878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91393757 91393913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91399218 91399345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 91403710 91404414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1542 nt):
ATGCGTTCACGGTGCACCGTCTCTGCCGTCGGTCTCCTCAGCTTGTGTCTTGTGGTGTCTGCGAGCCTAG
AG
ACTATCACACCGTCTGCTTTTGATGGGTATCCAGATGAACCTTGCACTATAAACATAACAATACGAAA
T
TCCCGGCTAATTTTATCCTGGGAATTAGAGAACAAGTCTGGCCCACCCGCTAACTACACCCTCTGGTAC
ACA
GTCATGAGCAAAGACGAAAATCTGACGAAGGTTAAGAACTGTTCAGATACCACGAAGTCATCATGTG
AC
GTGACAGATAAGTGGTTGGAGGGCATGGAGAGCTACGTCGTCGCCATCGTCATAGTGCACAGAGGGGA
C
TTGACCGTGTGCCGCTGCTCAGACTACATCGTGCCTGCAAACGCTCCTCTTGAGCCGCCAGAATTTGAG
ATC
GTTGGCTTTACAGACCACATAAACGTGACGATGGAATTTCCACCTGTCACTTCCAAAATAATCCAGG
AA
AAGATGAAGACTACACCCTTTGTCATCAAAGAACAGATAGGGGACAGCGTTAGGAAGAAGCACGAGCC
C
AAAGTGAATAATGTCACTGGGAACTTCACATTTGTCCTTAGAGACTTACTTCCAAAGACAAACTACTGT
GTA
TCTCTTTATTTTGATGATGACCCCGCAATAAAATCTCCCTTAAAATGCATCGTCCTTCAGCCTGGCC
AG
GAATCAGGATTATCAGAATCTGCTATAGTAGGAATAACTACTTCGTGTTTGGTAGTGATGGTTTTCGT
G
AGCACTATCGTAATGCTGAAACGGATTGGTTATATATGCCTAAAAGACAATTTGCCCAATGTCTTGAAC
TTC
CGCCACTTTTTAACCTGGATAATCCCTGAACGGTCACCTTCAGAAGCCATCGATCGGCTGGAAATCA
TC
CCCACAAACAAGAAGAAGAGACTGTGGAATTACGATTATGAGGATGGCAGTGACAGTGACGAAGAGGT
C
CCCACAGCAAGTGTCACTGGCTACACCATGCATGGACTGACGGGCAAGCCTCTGCAACAAACCTCTGAC
ACC
TCAGCCAGCCCCGAGGATCCCCTGCATGAAGAAGATTCAGGCGCTGAGGAATCTGATGAAGCTGGAG
CA
GGGGCTGGAGCTGAGCCAGAACTCCCCACAGAGGCGGGGGCGGGGCCTTCAGAAGACCCCACTGGCCC
C
TATGAGAGAAGAAAGAGTGTGCTCGAGGACTCATTCCCCAGGGAGGACAACAGCTCCATGGATGAGCCT
GGG
GACAACATTATCTTCAACGTGAACTTAAACTCTGTGTTTCTGAGGGTTCTCCATGATGAAGATGCCT
CA
GAGACATTATCTCTCGAAGAAGACACCATCCTCCTAGACGAAGGTCCCCAGAGGACAGAGTCAGACCT
T
CGGATAGCTGGTGGGGACAGGACACAGCCGCCCCTCCCCAGCCTTCCTTCCCAGGATCTATGGACTGAA
GAT
GGGTCATCTGAGAAATCAGACACCTCAGATTCCGATGCTGATGTGGGGGACGGCTACATCATGAGAT
GA


Translation (513 aa):
MRSRCTVSAVGLLSLCLVVSASLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWY
T
VM
SKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFE
I
VGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKK
HEPKVNNVTGNFTFVLRDLLPKTNYC
V
SLYFDDDPAIKSPLKCIVLQPGQES
GLSESAIVGITTSCLVVMVFVSTIVMLKRIGYICLKDNLPNVLN
F
RHFLTWIIPERSPSEAIDRLEIIPTNKKKRLWNYDYEDGSDSDEEVPTASVTGYTMHGLTGKPLQQTSD
T
SASPEDPLHEEDSGAEESDEAGAGAGAEPELPTEAGAGPSEDPTGPYERRKSVLEDSFPREDNSSMDEP
G
DNIIFNVNLNSVFLRVLHDEDASETLSLEEDTILLDEGPQRTESDLRIAGGDRTQPPLPSLPSQDLWTE
D
GSSEKSDTSDSDADVGDGYIMR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser