NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28270.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28270.1 Public Mus musculus 16 Cadm2 21 106 86 CCDS HistoryNCBI Gene:239857Re-query CCDS DB by CCDS ID:28270.1Re-query CCDS DB by GeneID:239857See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28270.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000114292 ENSMUSP00000109931 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114292Link to Ensembl Protein Viewer:ENSMUSP00000109931Re-query CCDS DB by Nucleotide ID:ENSMUST00000114292Re-query CCDS DB by Protein ID:ENSMUSP00000109931
Original member Current member EBI,WTSI OTTMUST00000041387 OTTMUSP00000018568 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041387Link to Vega Protein Viewer:OTTMUSP00000018568Re-query CCDS DB by Nucleotide ID:OTTMUST00000041387Re-query CCDS DB by Protein ID:OTTMUSP00000018568
Original member Current member NCBI NM_178721.4 NP_848836.2 Accepted alive Link to Nucleotide Sequence:NM_178721.4Link to Protein Sequence:NP_848836.2Re-query CCDS DB by Nucleotide ID:NM_178721Re-query CCDS DB by Protein ID:NP_848836Link to BLAST:NP_848836.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848836.2 404 Q8BLQ9-2 404 100% 0 0

Chromosomal Locations for CCDS 28270.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 66663093 66663211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66664381 66664506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66747199 66747377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66771607 66771697 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66784717 66784887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66812730 66812867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66815309 66815461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66882733 66882882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 66953274 66953300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 67620171 67620231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1215 nt):
ATGATTTGGAAACGCAGCGCGGTTCTCCGCTTCTACAGTGTCTGCGGGCTCCTGTTACAAGCGGCTGCTT
CA
AAAAGTAAAGTCAAAGGCAGCCAAGGGCAGTTTCCACTAACTCAGAATGTCACGGTTGTTGAAGGTGG
A
ACTGCAATTTTGACCTGCAGAGTTGATCAAAATGATAACACCTCCCTCCAGTGGTCAAATCCAGCTCAA
CAG
ACTCTGTACTTCGATGACAAGAAAGCTTTAAGGGACAATCGGATCGAGCTGGTTCGCGCTTCTTGGC
AT
GAGTTGAGCATCAGTGTCAGTGATGTGTCTCTCTCGGATGAAGGACAGTACACCTGCTCCTTATTTAC
A
ATGCCTGTCAAAACTTCCAAGGCCTATCTCACTGTCCTGGGTGTTCCGGAGAAGCCTCAGATTAGTGGA
TTT
TCGTCACCCGTCATGGAGGGAGACCTGATGCAGCTGACGTGTAAGACGTCCGGCAGTAAGCCTGCGG
CT
GATATAAGATGGTTCAAAAATGACAAAGAAATCAAAGATGTGAAGTACTTGAAAGAGGAGGATGCTAA
C
CGAAAGACCTTCACCGTTAGCAGCACGCTGGATTTCCGAGTGGACCGTAGCGATGATGGAGTGGCGGTC
ATC
TGCAGAGTAGACCATGAGTCCCTCAATGCCACCCCTCAGGTAGCCATGCAGGTGCTAGAAATTCACT
AT
ACACCATCAGTTAAGATTATACCATCGACTCCTTTTCCACAAGAAGGGCAGGCTTTAACGTTGACCTG
T
GAATCTAAAGGAAAACCACTGCCAGAACCTGTTTTGTGGACGAAAGATGGTGCCGAATTACCAGATCCT
GAT
CGAATGGTTGTGAGTGGTAGGGAACTCAACATTCTCTTCCTGAACAAAACGGACAATGGCACTTACC
GA
TGTGAAGCCACTAACACCATTGGCCAAAGCAGTGCCGAGTATGTCCTCATTGTTCACGATCCCAATTC
T
CTGGCTGGCCAGAATGGCCCTGACCATGCTCTCATCGGAGGAATAGTGGCTGTTGTTGTATTTGTTACA
CTG
TGCTCCATATTCCTGCTTGGCCGATATCTGGCAAGACATAAAGGAACATATCTAACAAATGAAGCTA
AA
GGAGCCGAAGATGCACCAGATGCCGACACAGCCATTATCAATGCTGAAGGCAGCCAAGTCAATGCCGA
A
GAGAAAAAAGAGTATTTCATTTAA


Translation (404 aa):
MIWKRSAVLRFYSVCGLLLQAAASKSKVKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQ
Q
TLYFDDKK
ALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISG
F
SSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIK
DVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAV
I
CRVDHESLNATPQVAMQVLEIH
YTPSVKIIPSTPFPQEGQALTLTCESKGKPLPEPVLWTKDGAELPDP
D
RMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVH
DPNSLAGQNGPDHALIGGIVAVVVFVT
L
CSIFLLGRYLARHK
GTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser