NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27972.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27972.1 Public Mus musculus 16 Myh11 21 106 86 CCDS HistoryNCBI Gene:17880Re-query CCDS DB by CCDS ID:27972.1Re-query CCDS DB by GeneID:17880See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27972.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000090287 ENSMUSP00000087756 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000090287Link to Ensembl Protein Viewer:ENSMUSP00000087756Re-query CCDS DB by Nucleotide ID:ENSMUST00000090287Re-query CCDS DB by Protein ID:ENSMUSP00000087756
Original member Current member NCBI NM_013607.2 NP_038635.2 Accepted alive Link to Nucleotide Sequence:NM_013607.2Link to Protein Sequence:NP_038635.2Re-query CCDS DB by Nucleotide ID:NM_013607Re-query CCDS DB by Protein ID:NP_038635Link to BLink:NP_038635.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038635.2 1938 O08638-2 1938 99.4324% 0 11

Chromosomal Locations for CCDS 27972.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 14198058 14198088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14200695 14200867 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14200969 14201077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14202063 14202271 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14203113 14203236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14204325 14204413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14204631 14204759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14205107 14205268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14205501 14205713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14205911 14206123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14207540 14207788 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14207989 14208141 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14208232 14208336 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14209511 14209717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14211226 14211370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14212518 14212730 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14215736 14215907 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14217942 14218065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14218840 14218977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14219860 14220066 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14220155 14220286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14221744 14221852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14223496 14223656 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14223816 14223885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14223978 14224099 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14226459 14226652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14228736 14228850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14230693 14230866 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14232525 14232698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14233540 14233692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14234353 14234471 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14236369 14236464 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14239396 14239539 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14244805 14244903 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14245501 14245564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14246727 14246819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14250522 14250624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14256485 14256512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14269109 14269265 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 14277552 14277896 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5817 nt):
ATGGCGCAGAAAGGGCAGCTCAGCGATGATGAGAAGTTCCTCTTTGTGGATAAAAACTTCATGAACAGCC
CA
ATGGCTCAGGCCGACTGGGTAGCCAAGAAGCTGGTGTGGGTCCCTTCAGAGAAGCAGGGCTTCGAAGC
A
GCCAGCATCAAGGAGGAGAAGGGCGATGAGGTGGTCGTGGAGTTGGTGGAAAATGGAAAGAAGGTCACA
GTT
GGCAAAGATGACATCCAAAAAATGAACCCACCCAAGTTCTCTAAGGTGGAGGACATGGCAGAGCTGA
CG
TGCCTCAATGAGGCCTCTGTGCTGCACAACCTGAGGGAGCGATACTTCTCAGGCCTCATCTATACCTA
C
TCTGGCCTCTTCTGTGTGGTGGTCAACCCCTACAAGTACCTACCCATCTACTCAGAAAAGATCGTGGAT
ATG
TACAAGGGCAAGAAGAGGCATGAGATGCCGCCTCACATCTATGCCATTGCCGACACAGCCTACAGAA
GC
ATGCTACAAGATCGTGAAGACCAGTCCATTCTGTGCACAGGTGAGTCTGGAGCCGGAAAGACAGAGAA
C
ACAAAGAAAGTCATACAGTACTTGGCTGTGGTGGCATCCTCCCACAAGGGCAAGAAAGACAGCAGCATC
ACG
GGGGAGCTGGAAAAGCAGCTTCTACAGGCAAACCCAATCCTGGAGGCTTTCGGCAATGCGAAAACCG
TC
AAGAACGACAACTCCTCTCGCTTTGGCAAGTTCATTCGCATCAACTTCGATGTCACTGGTTACATTGT
A
GGTGCCAATATTGAAACATATCTTCTGGAAAAGTCTAGGGCTATTCGACAGGCTAGGGATGAGAGAACA
TTT
CACATCTTCTACTACCTGCTCGCCGGAGCCAAGGAAAAGATGAAAAGTGACCTGCTTTTGGAGAGCT
TC
AACAGCTACACATTTTTATCCAATGGCTTTGTGCCCATCCCAGCTGCACAAGATGATGAGATGTTCCA
G
GAGACACTGGAAGCCATGTCTATCATGGGCTTCAATGAAGAGGAACAGCTAGCCATCTTGAAGGTAGTA
TCA
TCTGTCCTTCAGCTTGGAAACATTGTCTTCAAGAAGGAGCGAAACACAGACCAGGCATCCATGCCTG
AT
AACACAGCGGCTCAGAAAGTTTGCCACCTCGTGGGGATTAATGTGACAGATTTCACTAGAGCCATCCT
G
ACCCCACGTATCAAAGTTGGACGGGATGTGGTGCAGAAGGCTCAGACCAAAGAACAGGCTGACTTTGCC
ATC
GAGGCCTTAGCCAAGGCCACCTATGAGCGCCTTTTCCGATGGATTCTCAGCCGTGTAAACAAGGCCT
TG
GACAAGACCCATCGGCAGGGGGCCTCCTTCCTGGGCATTCTGGATATTGCTGGGTTTGAAATCTTTGA
G
GTAAACTCCTTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTGTTCAACCACACG
ATG
TTCATCCTGGAGCAGGAAGAGTACCAGCGAGAGGGCATCGAGTGGAACTTCATCGACTTCGGCCTGG
AC
CTGCAGCCTTGTATTGAGCTGATTGAGCGGCCGAACAACCCTCCCGGTGTGCTGGCCCTGCTGGATGA
A
GAATGCTGGTTCCCCAAAGCTACAGACAAGTCTTTTGTGGAGAAGCTATGCTCAGAGCAGGGAAATCAC
CCC
AAATTTCAGAAGCCCAAGCAGCTAAAGGACAAAACAGAGTTCTCCATCATCCACTATGCTGGGAAGG
TG
GACTACAATGCAAGTGCCTGGCTGACCAAGAACATGGACCCGCTAAATGACAATGTGACATCACTCCT
C
AATGCCTCCTCTGACAAGTTTGTGGCTGACCTGTGGAAGGATGTGGACCGCATTGTGGGGCTGGACCAG
ATG
GCCAAGATGACTGAGAGCTCACTGCCCAGTGCCTCCAAGACCAAAAAGGGCATGTTCCGCACCGTGG
GC
CAGCTCTACAAAGAGCAGTTGGGGAAACTGATGACTACACTGCGCAATACCACGCCTAACTTTGTGCG
C
TGCATCATCCCCAACCATGAGAAGAGGTCTGGCAAGCTGGATGCATTTCTAGTGCTGGAACAGCTGCGC
TGC
AACGGTGTGTTGGAAGGCATCCGCATCTGCCGTCAGGGCTTCCCCAACAGGATTGTCTTCCAAGAGT
TC
CGGCAACGCTATGAGATCCTGGCAGCGAACGCCATCCCCAAAGGCTTCATGGATGGAAAGCAAGCCTG
C
ATTCTCATGATCAAAGCCCTCGAACTTGACCCTAACCTGTACAGGATTGGGCAGAGCAAAATCTTCTTC
CGA
ACGGGGGTCCTGGCCCACCTAGAGGAGGAACGAGACCTGAAAATTACTGATGTCATCATGGCCTTCC
AG
GCAATGTGTCGTGGCTACCTTGCCAGAAAGGCCTTCACCAAGAGGCAGCAACAGCTGACAGCCATGAA
G
GTGATCCAGAGGAACTGCGCTGCCTACCTTAAGCTCCGCAACTGGCAATGGTGGCGGCTCTTCACCAAA
GTA
AAGCCATTGCTCCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGAGGAGATGCAAAAGA
TC
AAGGAGCGGCAGCAGAAGGCAGAGACTGAGTTGAAGGAGCTGGAGCAGAAGCACACTCAGCTGGCTGA
G
GAGAAGACTCTGCTGCAGGAGCAGTTGCAGGCAGAGACAGAGCTGTATGCTGAGGCTGAGGAGATGCGG
GTC
CGGTTGGCAGCCAAGAAGCAGGAACTGGAGGAGATCCTACATGAGATGGAGGCCCGCCTGGAGGAAG
AG
GAAGACCGGGGCCAGCAACTACAGGCTGAGAGGAAGAAGATGGCTCAGCAGATGCTAGACCTGGAGGA
G
CAACTGGAGGAGGAAGAGGCCGCCAGACAGAAACTACAGCTAGAGAAGGTCACGGCTGAGGCCAAGATC
AAG
AAACTGGAGGATGACATCTTGGTTATGGATGATCAGAACAGTAAACTTTCAAAAGAACGAAAACTCC
TT
GAAGAGAGGGTCAGCGACTTGACAACCAACCTAGCAGAAGAGGAAGAAAAGGCTAAAAACCTCACAAA
G
CTGAAGAGCAAGCATGAGTCTATGATCTCAGAGCTGGAGGTGAGGCTGAAGAAAGAGGAGAAGAGCCGG
CAG
GAGCTGGAGAAACTCAAGAGGAAACTGGAGGGTGATGCCAGTGACTTCCATGAGCAGATCGCTGACT
TG
CAGGCCCAGATTGCAGAGCTCAAGATGCAGCTGGCAAAGAAAGAGGAAGAGCTACAGGCAGCTCTAGC
C
AGGCTTGATGAAGAGATCGCCCAGAAAAACAATGCCCTAAAGAAGATTCGCGAGCTAGAGGGCCATATC
TCA
GACCTACAAGAGGACCTAGACTCAGAGCGGGCTGCCAGGAACAAGGCCGAGAAGCAGAAGCGAGACC
TG
GGGGAGGAGCTGGAGGCACTCAAGACGGAGCTGGAGGATACGCTGGACAGCACAGCTACCCAGCAGGA
G
CTCAGAGCCAAGAGGGAACAGGAGGTGACAGTGCTGAAGAAGGCCCTGGATGAGGAGACGCGGTCCCAT
GAG
GCCCAGGTCCAGGAGATGAGGCAGAAGCACACACAGGCAGTGGAGGAACTCACAGAGCAGCTGGAGC
AG
TTCAAAAGGGCCAAGGCAAACCTGGACAAAAGCAAGCAGACACTGGAGAAGGAGAACGCGGACCTGGC
T
GGGGAGCTGCGTGTCCTGGGCCAGGCGAAGCAGGAGGTGGAACACAAGAAGAAGAAGCTGGAGGTGCAG
CTG
CAGGATCTGCAGTCCAAGTGCAGTGATGGGGAGCGTGCCCGGGCTGAGCTCAGTGACAAGGTCCACA
AG
CTACAGAATGAAGTGGAGAGTGTCACTGGCATGCTCAATGAGGCAGAGGGCAAAGCCATCAAACTGGC
C
AAAGATGTGGCTTCCCTTGGATCCCAGCTTCAGGACACCCAAGAGCTGCTCCAAGAAGAAACCCGGCAG
AAG
CTCAATGTGTCTACCAAGCTGCGTCAGTTGGAAGATGAAAGGAACAGCCTGCAGGACCAGCTGGATG
AG
GAGATGGAGGCTAAGCAAAACCTGGAGCGCCATGTCTCAACACTGAACATTCAGCTCTCAGACTCTAA
G
AAGAAGCTGCAGGACTTTGCAAGTACCATCGAGGTCATGGAGGAGGGGAAGAAGAGGTTACAGAAAGAG
ATG
GAGGGCCTCAGCCAGCAGTATGAGGAGAAGGCGGCTGCCTATGACAAACTGGAGAAAACCAAGAACA
GG
CTCCAGCAGGAGCTGGATGACCTGGTCGTGGACTTGGACAACCAGCGGCAACTGGTATCCAATCTGGA
A
AAGAAGCAGAAGAAATTTGACCAGTTGTTAGCTGAGGAGAAGAACATCTCCTCCAAGTATGCGGATGAG
AGA
GACCGAGCTGAAGCAGAGGCCAGGGAAAAGGAGACAAAGGCTTTGTCTCTAGCCCGGGCCCTGGAGG
AA
GCCCTGGAAGCCAAAGAAGAGCTGGAGAGGACCAACAAGATGCTCAAAGCTGAGATGGAAGACCTGGT
C
AGCTCCAAGGATGATGTAGGCAAGAACGTGCATGAACTGGAGAAGTCCAAGCGTGCCTTGGAGACCCAG
ATG
GAAGAGATGAAAACCCAGCTGGAGGAGTTGGAGGATGAGCTGCAGGCCACTGAGGATGCCAAGCTGC
GG
CTAGAGGTCAACATGCAGGCCCTCAAGGGCCAGTTTGAACGCGATCTCCAGGCTCGGGATGAACAGAA
T
GAGGAGAAGAGGAGGCAGCTACAGCGGCAGCTGCACGAGTATGAGACAGAACTGGAAGATGAACGGAAG
CAG
AGAGCTCTGGCGGCGGCAGCTAAGAAGAAGCTGGAAGGGGACCTAAAAGACCTAGAGCTCCAGGCTG
AC
TCAGCCATCAAAGGGAGGGAGGAAGCCATCAAGCAGCTTCGAAAACTGCAGGCTCAGATGAAGGACTT
C
CAAAGAGAGCTGGATGATGCCCGTGCCTCCAGGGATGAGATCTTTGCCACCTCAAAAGAGAATGAGAAG
AAA
GCCAAGAGTCTGGAGGCAGACCTCATGCAGCTCCAAGAGGACCTGGCAGCAGCTGAGAGAGCTCGCA
AG
CAAGCTGACCTGGAGAAGGAGGAGCTGGCCGAGGAGCTGGCTAGCAGCTTGTCAGGAAGGAATACACT
G
CAGGATGAGAAGCGCCGCCTGGAGGCAAGGATCGCCCAACTAGAGGAGGAGCTGGAGGAAGAGCAGGGC
AAC
ATGGAGGCCATGAGTGATAGAGTACGCAAGGCCACACTGCAGGCTGAGCAACTGAGCAATGAGCTGG
CC
ACAGAACGCAGCACGGCTCAGAAGAATGAGAGCGCACGGCAACAGCTGGAGCGCCAGAACAAGGAACT
G
CGAAGCAAGTTGCAGGAGGTAGAAGGTGCTGTCAAAGCCAAGCTCAAGTCCACTGTTGCGGCGCTGGAG
GCC
AAGATTGCACAGCTGGAGGAGCAGGTTGAACAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGC
TG
AAGCAAAAGGACAAGAAGCTAAAGGAGGTCCTGCTGCAGGTGGAGGATGAGCGCAAGATGGCAGAGCA
G
TACAAGGAGCAGGCAGAGAAAGGAAACACCAAGGTCAAGCAGCTGAAGAGGCAGCTGGAAGAGGCAGAG
GAG
GAGTCCCAGCGCATCAACGCCAACCGCAGGAAGCTGCAGCGGGAGCTAGATGAGGCCACAGAGAGCA
AT
GAGGCCATGGGCCGTGAGGTGAACGCCCTCAAGAGCAAACTCAGAGGGCCCCCCCCACAGGAAACTTC
G
CAGTGA


Translation (1938 aa):
MAQKGQLSDDEKFLFVDKNFMNSPMAQADWVAKKLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVT
V
GKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIY
TYSGLFCVVVNPYKYLPIYSEKIVD
M
YKGKKRHEMPPHIYAIADTAYRSMLQ
DREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDSSI
T
GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERT
F
HIFYYLLAGAKEKMK
SDLLLESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFNEEEQLAILKVV
S
SVLQLGNIVFKKERNTDQASMPDNT
AAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQADFA
I
EALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFE
VNSFEQLCINYTNEKLQQLFNHT
M
FILEQEEYQREGIEWNFIDFGLDLQPCIELIERP
NNPPGVLALLDEECWFPKATDKSFVEKLCSEQGNH
P
KFQKPKQLKDKTEFSIIHYAGK
VDYNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQ
M
AKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKR
SGKLDAFLVLEQLR
C
NGVLEGIRICRQGFPNRIVFQEFRQ
RYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFF
R
TGVLAHLEEERDLKITDVIMAFQAMCRGYLAR
KAFTKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK
V
KPLLQVTRQEEEMQAKEEEMQKIKERQQKAETELKELEQKHTQ
LAEEKTLLQEQLQAETELYAEAEEMR
V
RLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQML
DLEEQLEEEEAARQKLQLEKVTAEAKI
K
KLEDDILVMDDQNSKLSK
ERKLLEERVSDLTTNLAEEEEKAKNLTKLKSKHESMISELEVRLKKEEKSR
Q
ELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALA
RLDEEIAQKNNALKKIRELEGHI
S
DLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQEL
RAKREQEVTVLKKALDEETRSH
E
AQVQEMRQKHTQAVEELTEQLEQFKR
AKANLDKSKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEVQ
L
QDLQSKCSDGERARAELSDKVHKLQ
NEVESVTGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEETRQ
K
LNVSTKLRQLEDERNSLQDQLDEEMEAKQNLERHVSTLNIQ
LSDSKKKLQDFASTIEVMEEGKKRLQKE
M
EGLSQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQKKFDQ
LLAEEKNISSKYADE
R
DRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKN
VHELEKSKRALETQ
M
EEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQ
LHEYETELEDERK
Q
RALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQ
AQMKDFQRELDDARASRDEIFATSKENEK
K
AKSLEADLMQLQE
DLAAAERARKQADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQLEEELEEEQG
N
MEAMSDRVRKATLQ
AEQLSNELATERSTAQKNESARQQLERQNKELRSKLQEVEGAVKAKLKSTVAALE
A
KIAQLEEQVEQEA
REKQAATKSLKQKDKKLKEVLLQVEDERKMAEQYKEQAEKGNTKVKQLKRQLEEAE
E
ESQRINANRRKLQRELDEATESNEAMGREVNALKSKL
RGPPPQETSQ



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser