NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27875.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27875.1 Public Mus musculus 15 Rarg 21 106 86 CCDS HistoryNCBI Gene:19411Re-query CCDS DB by CCDS ID:27875.1Re-query CCDS DB by GeneID:19411See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27875.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000043172 ENSMUSP00000048838 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000043172Link to Ensembl Protein Viewer:ENSMUSP00000048838Re-query CCDS DB by Nucleotide ID:ENSMUST00000043172Re-query CCDS DB by Protein ID:ENSMUSP00000048838
Original member Current member EBI,WTSI OTTMUST00000072430 OTTMUSP00000037288 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000072430Link to Vega Protein Viewer:OTTMUSP00000037288Re-query CCDS DB by Nucleotide ID:OTTMUST00000072430Re-query CCDS DB by Protein ID:OTTMUSP00000037288
Original member Current member NCBI NM_011244.4 NP_035374.3 Accepted alive Link to Nucleotide Sequence:NM_011244.4Link to Protein Sequence:NP_035374.3Re-query CCDS DB by Nucleotide ID:NM_011244Re-query CCDS DB by Protein ID:NP_035374Link to BLAST:NP_035374.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035374.3 458 P18911-1 458 100% 0 0

Chromosomal Locations for CCDS 27875.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 102236024 102236223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102238805 102238963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102239390 102239594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102239858 102240034 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102240128 102240288 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102241058 102241199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102241836 102241984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102252419 102252602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1377 nt):
ATGGCCACCAATAAGGAGAGACTCTTTGCGCCCGGTGCCCTGGGGCCTGGATCTGGTTACCCAGGAGCAG
GC
TTCCCATTCGCCTTCCCAGGTGCACTCAGAGGGTCGCCACCATTTGAGATGCTGAGCCCTAGCTTCCG
G
GGCCTGGGCCAGCCTGACCTCCCCAAGGAGATGGCTTCTCTCTCGGTGGAGACACAGAGCACCAGCTCG
GAG
GAGATGGTACCCAGCTCTCCCTCACCCCCACCACCTCCTCGGGTCTATAAGCCATGCTTTGTATGCA
AT
GACAAGTCTTCTGGCTACCACTATGGGGTCAGCTCCTGTGAAGGCTGCAAGGGCTTCTTCAGACGCAG
C
ATTCAGAAAAACATGGTGTATACATGTCACCGTGACAAAAACTGTATCATCAACAAGGTCACCAGAAAT
CGA
TGCCAGTACTGCAGGCTACAAAAGTGTTTCGAAGTGGGCATGTCCAAGGAAGCTGTAAGGAACGATC
GA
AACAAGAAGAAAAAGGAGGTAAAAGAGGAGGGCTCGCCCGACAGCTATGAACTGAGTCCACAGTTAGA
G
GAACTCATCACCAAGGTCAGCAAAGCCCACCAGGAGACTTTTCCCTCACTCTGCCAGCTGGGCAAGTAC
ACC
ACGAACTCCAGTGCAGATCACCGGGTGCAGCTGGACCTGGGGCTGTGGGACAAGTTCAGCGAGCTGG
CC
ACCAAATGCATCATCAAGATTGTGGAGTTTGCGAAGCGGCTGCCTGGTTTTACAGGGCTCAGCATTGC
C
GACCAGATCACGCTGCTCAAGGCTGCTTGTCTGGACATCCTAATGCTGCGGATCTGTACAAGGTATACC
CCA
GAGCAGGACACTATGACATTCTCGGATGGGCTGACCCTGAACCGAACCCAGATGCACAATGCTGGCT
TT
GGGCCCCTTACAGACCTCGTCTTTGCCTTTGCCGGGCAGCTGCTGCCCCTGGAGATGGATGACACCGA
G
ACTGGGCTACTTAGTGCTATCTGCCTCATCTGTGGAGACCGAATGGACCTGGAAGAGCCCGAGAAGGTG
GAC
AAGCTGCAGGAGCCCCTGCTGGAAGCCCTGAGGCTCTATGCCCGGCGACGGAGACCCAGCCAACCCT
AC
ATGTTCCCAAGGATGCTGATGAAAATCACCGACCTCCGGGGCATCAGCACTAAGGGAGCAGAAAGGGC
T
ATAACCCTGAAGATGGAGATTCCAGGCCCGATGCCACCCCTGATCCGAGAGATGCTGGAGAACCCGGAG
ATG
TTTGAGGACGACTCCTCGAAGCCTGGCCCCCACCCCAAGGCTTCCAGTGAGGACGAAGCTCCAGGGG
GC
CAGGGCAAAAGGGGCCAAAGTCCCCAACCTGACCAGGGGCCCTGA


Translation (458 aa):
MATNKERLFAPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS
E
EMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCK
GFFRRSIQKNMVYTCHRDKNCIINKVTRN
R
CQYCRLQKCFEVGMSKE
AVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKY
T
T
NSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYT
P
EQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICG
DRMDLEEPEKV
D
KLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTK
GAERAITLKMEIPGPMPPLIREMLENPE
M
FEDDSSKPGPHPKASSEDEAPGGQGKRGQSPQPDQGP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser