NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27807.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27807.1 Public Mus musculus 15 Wnt1 21 106 86 CCDS HistoryNCBI Gene:22408Re-query CCDS DB by CCDS ID:27807.1Re-query CCDS DB by GeneID:22408See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27807.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023734 ENSMUSP00000023734 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023734Link to Ensembl Protein Viewer:ENSMUSP00000023734Re-query CCDS DB by Nucleotide ID:ENSMUST00000023734Re-query CCDS DB by Protein ID:ENSMUSP00000023734
Original member Current member EBI,WTSI OTTMUST00000049616 OTTMUSP00000023019 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049616Link to Vega Protein Viewer:OTTMUSP00000023019Re-query CCDS DB by Nucleotide ID:OTTMUST00000049616Re-query CCDS DB by Protein ID:OTTMUSP00000023019
Original member Current member NCBI NM_021279.4 NP_067254.1 Accepted alive Link to Nucleotide Sequence:NM_021279.4Link to Protein Sequence:NP_067254.1Re-query CCDS DB by Nucleotide ID:NM_021279Re-query CCDS DB by Protein ID:NP_067254Link to BLink:NP_067254.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067254.1 370 P04426 370 100% 0 0

Chromosomal Locations for CCDS 27807.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 98790189 98790292 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98790864 98791117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98791692 98791957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98792416 98792904 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1113 nt):
ATGGGGCTCTGGGCGCTGCTGCCCAGCTGGGTTTCTACTACGTTGCTACTGGCACTGACCGCTCTGCCCG
CA
GCCCTGGCTGCCAACAGTAGTGGCCGATGGTGGGGCATCGTGAACATAGCCTCCTCCACGAACCTGTT
G
ACGGATTCCAAGAGTCTGCAGCTGGTGCTCGAGCCCAGTCTGCAGCTGCTGAGCCGCAAGCAGCGGCGA
CTG
ATCCGACAGAACCCGGGGATCCTGCACAGCGTGAGTGGAGGGCTCCAGAGCGCTGTGCGAGAGTGCA
AA
TGGCAATTCCGAAACCGCCGCTGGAACTGCCCCACTGCTCCGGGGCCCCACCTCTTCGGCAAGATCGT
C
AACCGAGGCTGCCGAGAAACAGCGTTCATCTTCGCAATCACCTCCGCCGGGGTCACACATTCCGTGGCG
CGC
TCCTGCTCCGAAGGCTCCATCGAGTCCTGCACCTGCGACTACCGGCGGCGCGGCCCTGGGGGCCCCG
AC
TGGCACTGGGGGGGCTGCAGTGACAACATCGATTTTGGTCGCCTCTTTGGCCGAGAGTTCGTGGACTC
C
GGGGAGAAGGGGCGGGACCTACGCTTCCTCATGAACCTTCACAACAACGAGGCAGGGCGAACGACCGTG
TTC
TCTGAGATGCGCCAAGAGTGCAAATGCCACGGGATGTCCGGCTCCTGCACGGTGCGCACGTGTTGGA
TG
CGGCTGCCCACGCTGCGCGCTGTGGGCGACGTGCTGCGCGACCGCTTCGACGGCGCCTCCCGCGTCCT
T
TACGGCAACCGAGGCAGCAACCGCGCCTCGCGGGCGGAGCTGCTGCGCCTGGAGCCCGAAGACCCCGCG
CAC
AAGCCTCCCTCCCCTCACGACCTCGTCTACTTCGAGAAATCGCCCAACTTCTGCACGTACAGTGGCC
GC
CTGGGCACAGCTGGCACAGCTGGACGAGCTTGCAACAGCTCGTCTCCCGCGCTGGACGGCTGTGAGCT
G
CTGTGCTGTGGCCGAGGCCACCGCACGCGCACGCAGCGCGTCACGGAGCGCTGCAACTGCACCTTCCAC
TGG
TGCTGCCACGTCAGCTGCCGCAACTGCACGCACACGCGCGTTCTGCACGAGTGTCTATGA


Translation (370 aa):
MGLWALLPSWVSTTLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRR
L
IRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNR
GCRETAFIFAITSAGVTHSVA
R
SCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRT
TV
F
SEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPA
H
KPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFH
W
CCHVSCRNCTHTRVLHECL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser