NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27803.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27803.1 Public Mus musculus 15 Fkbp11 21 106 86 CCDS HistoryNCBI Gene:66120Re-query CCDS DB by CCDS ID:27803.1Re-query CCDS DB by GeneID:66120See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27803.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000003445 ENSMUSP00000003445 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003445Link to Ensembl Protein Viewer:ENSMUSP00000003445Re-query CCDS DB by Nucleotide ID:ENSMUST00000003445Re-query CCDS DB by Protein ID:ENSMUSP00000003445
Original member Current member NCBI NM_024169.3 NP_077131.2 Accepted alive Link to Nucleotide Sequence:NM_024169.3Link to Protein Sequence:NP_077131.2Re-query CCDS DB by Nucleotide ID:NM_024169Re-query CCDS DB by Protein ID:NP_077131Link to BLink:NP_077131.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077131.2 201 Q9D1M7 201 100% 0 0

Chromosomal Locations for CCDS 27803.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 98724385 98724602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98726484 98726554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98726900 98726933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98727211 98727298 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98727683 98727748 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98727957 98728085 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (606 nt):
ATGACCCTGAGCCCTTTGCTCCTACCACTCCAGCTGTTACTGCTGCTACTGTTCAGTGGGGCGGTGTGCC
GG
GCTGAGGCTGGGCCAGAAACCGAAAGTCCTGTCCGGACCCTCCAAGTGGAGACCCTGGTGCAGCCCCC
T
GAATCGTGCACGGAATCTGCTGCCATTGGAGACACGCTCCACATACACTACACGGGCAGTTTGGTAGAT
GGA
CGCATTATTGACACTTCTCTGACCAGAGATCCTCTGGTCATAGAACTCGGCCAAAAGCAGGTGATTC
CA
GGTCTGGAGCAGAGCCTTTTGGACATGTGTGTGGGAGAGAAGCGAAGAGCAGTCATTCCTTCTCACCT
G
GCTTATGGAAAGCGAGGGTACCCGCCATCTATCCCAGCCGATGCAGTGGTGCAGTACGATGTGGAGCTG
ATC
GCTTTGATTCGAGCCAACTACTGGCAGAAGCTGCTAAAGAGCATTTTGCCTCTGGTAGGCATCGCCA
TG
GTGCCGGCGCTCCTGGGGCTGATCGGGTATCACCTGTACAGAAAGGCCAGCAGACCCAAAGTCTCCAA
A
AAGAAGCTAAAAGAGGAGAAACGAAACAAGAGTAAGAAGAAATAA


Translation (201 aa):
MTLSPLLLPLQLLLLLLFSGAVCRAEAGPETESPVRTLQVETLVQPPESCTESAAIGDTLHIHYTGSLVD
G
RIIDTSLTRDPLVIELGQKQVIP
GLEQSLLDMCVGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVEL
I
ALIRANYWQKLLKSILPLVGIAMVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKSKKK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser