NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27702.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27702.1 Public Mus musculus 15 Ttll1 21 106 86 CCDS HistoryNCBI Gene:319953Re-query CCDS DB by CCDS ID:27702.1Re-query CCDS DB by GeneID:319953See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27702.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000016897 ENSMUSP00000016897 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000016897Link to Ensembl Protein Viewer:ENSMUSP00000016897Re-query CCDS DB by Nucleotide ID:ENSMUST00000016897Re-query CCDS DB by Protein ID:ENSMUSP00000016897
Original member Current member EBI,WTSI ENSMUST00000109480 ENSMUSP00000105106 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109480Link to Ensembl Protein Viewer:ENSMUSP00000105106Re-query CCDS DB by Nucleotide ID:ENSMUST00000109480Re-query CCDS DB by Protein ID:ENSMUSP00000105106
Original member Current member EBI,WTSI OTTMUST00000057014 OTTMUSP00000027458 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057014Link to Vega Protein Viewer:OTTMUSP00000027458Re-query CCDS DB by Nucleotide ID:OTTMUST00000057014Re-query CCDS DB by Protein ID:OTTMUSP00000027458
Original member Current member EBI,WTSI OTTMUST00000057015 OTTMUSP00000027459 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057015Link to Vega Protein Viewer:OTTMUSP00000027459Re-query CCDS DB by Nucleotide ID:OTTMUST00000057015Re-query CCDS DB by Protein ID:OTTMUSP00000027459
Original member Current member NCBI NM_178869.4 NP_849200.2 Accepted alive Link to Nucleotide Sequence:NM_178869.4Link to Protein Sequence:NP_849200.2Re-query CCDS DB by Nucleotide ID:NM_178869Re-query CCDS DB by Protein ID:NP_849200Link to BLink:NP_849200.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_849200.2 423 Q91V51 423 100% 0 0

Chromosomal Locations for CCDS 27702.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 83484184 83484313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83489469 83489632 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83492543 83492629 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83496272 83496415 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83497320 83497428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83498152 83498286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83499922 83500102 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83502081 83502289 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83505250 83505362 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1272 nt):
ATGGCGGGAAGGGTGAAGTGGGTCACTGACATTGAGAAGTCGGTACTAATCAACAACTTCGAGAAGAGAG
GG
TGGATCCAAGTGACAGAAAATGAAGACTGGAATTTTTACTGGATGAGCGTGCAAACCATTCGCAACGT
G
TTCAGCGTAGAAACTGGGTACCGGCTGTCAGACGACCAGATCGTCAACCATTTCCCCAACCACTACGAG
CTG
ACCCGCAAGGACCTGATGGTGAAGAACATTAAGAGATACAGGAAGGAGCTGGAGAAGGAAGGAAGTC
CC
TTGGCGGAGAAAGACGAGAATGGAAAATACCTCTATCTGGACTTTGTCCCCGTCACCTACATGCTCCC
C
GCCGACTACAACCTGTTTGTGGAAGAGTTCCGGAAGAGCCCGTCCAGCACCTGGATCATGAAGCCATGT
GGC
AAAGCACAGGGAAAAGGCATCTTCCTCATCAATAAGCTTTCGCAGATCAAAAAGTGGTCCCGGGACA
GC
AAGACGTCCTCGTTTGTGTCGCAGTCCACAAAAGAAGCGTACGTGATCTCAGTCTATATCAATAATCC
G
TTGCTCATCGGTGGAAGGAAGTTTGACCTTCGTCTGTATGTCCTGGTGTCCACGTACCGCCCGCTGCGC
TGC
TACATGTACAAGCTTGGGTTCTGCCGCTTCTGCACAGTGAAGTACACCCCTAGTACCAGTGAGCTCG
AC
AACATGTTTGTCCACCTTACCAACGTGGCCATCCAGAAGCATGGGGAGGACTACAACCACATCCACGG
T
GGCAAGTGGACTGTCAACAACCTGCGTCTCTACCTGGAGAGCACCCGAGGCCGAGAGGTGACCAGCAAG
CTG
TTTGATGAAATCCACTGGATCATCGTGCAGTCTCTCAAGGCCGTGGCGCCAGTGATGAACAACGACA
AA
CACTGCTTTGAATGCTACGGCTACGACATCATCATCGATGACAAGCTGAAGCCCTGGCTGATCGAGGT
C
AACGCGTCCCCGTCTCTCACATCCAGCACCGCCAACGATCGAATCCTTAAGTACAACCTGATTAACGAC
ACC
CTCAACATTGCGGTCCCCAACGGCGAGATTCCCGACTGCAAGTGGAACAAGTCTCCCCCCAAGGAAG
TA
CTTGGCAACTATGAGATCCTGTATGACGAGGAGCTGGCCCAGGGTGACGGGGCTGAACGAGAGCTTAG
A
AACCGCCCAGGCCAGCCAGTGGGGCCCAGAGCAGGCCGCTCGAGAGACTCAGGAAGAAGTGTCCTCACA
ACC
TGGAAGTGA


Translation (423 aa):
MAGRVKWVTDIEKSVLINNFEKRGWIQVTENEDWNFYWMSVQTIRNVFSVETGYRLSDDQIVNHFPNHYE
L
TRKDLMVKNIKRYRKELEKEGSPLAEKDENGKYLYL
DFVPVTYMLPADYNLFVEEFRKSPSSTWIMKPC
G
KAQGKGIFLINKLSQIKKWSRDSKTS
SFVSQSTKEAYVISVYINNPLLIGGRKFDLRLYVLVSTYRPLR
C
Y
MYKLGFCRFCTVKYTPSTSELDNMFVHLTNVAIQKHGEDYNHIHGGKWTVNNLRLYLESTRGREVTSK
L
FDEIHWIIVQSLKAVA
PVMNNDKHCFECYGYDIIIDDKLKPWLIEVNASPSLTSSTANDRILKYNLIND
T
LNIAVPNGEIPDCKWNKSPPKEVLGNYEI
LYDEELAQGDGAERELRNRPGQPVGPRAGRSRDSGRSVLT
T
WK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser