NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27686.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27686.1 Public Mus musculus 15 Naga 21 106 86 CCDS HistoryNCBI Gene:17939Re-query CCDS DB by CCDS ID:27686.1Re-query CCDS DB by GeneID:17939See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27686.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023088 ENSMUSP00000023088 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023088Link to Ensembl Protein Viewer:ENSMUSP00000023088Re-query CCDS DB by Nucleotide ID:ENSMUST00000023088Re-query CCDS DB by Protein ID:ENSMUSP00000023088
Original member Current member NCBI NM_008669.4 NP_032695.3 Accepted alive Link to Nucleotide Sequence:NM_008669.4Link to Protein Sequence:NP_032695.3Re-query CCDS DB by Nucleotide ID:NM_008669Re-query CCDS DB by Protein ID:NP_032695Link to BLAST:NP_032695.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032695.3 415 Q9QWR8 415 100% 0 0

Chromosomal Locations for CCDS 27686.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 82330061 82330207 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82330655 82330798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82332333 82332530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82334786 82334947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82335497 82335591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82335843 82336020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82336770 82336941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82337387 82337522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 82338238 82338253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1248 nt):
ATGTTGCAGAAGACAGTGCTCTTACTGGCCCTGGTGGCTCAGGTACTGATGCTGGAGAATGGGCTACTGC
GG
ACTCCACCCATGGGCTGGCTGGCCTGGGAACGCTTCCGCTGTAACATCGACTGTGTGGAGGACCCGAA
G
AACTGCATCAGTGAACGGCTCTTTATGGAGATGGCGGACAGACTGGCCCAGGATGGATGGCGGGACCTG
GGC
TATGTATACCTCAACATCGATGACTGCTGGATTGGTGGGCGTGACGCCTCAGGCCGCCTAATTCCTG
AT
CCCAAGCGCTTCCCTCACGGGATTGCCTTCCTAGCTGACTATGCTCACTCTTTGGGTCTGAAGCTGGG
C
ATCTATGAGGACATGGGCAAAATGACCTGCATGGGTTACCCTGGTACCACCCTAGACAAAGTGGAGCTG
GAC
GCGGAAACCTTCGCGGAGTGGAAGGTGGACATGCTGAAGTTGGATGGCTGTTTCTCCAGCTCCAGAG
AA
CGTGCAGAGGGGTACCCCAAGATGGCTGCTGCCCTGAACGCCACGGGCCGTCCCATTGCCTTTTCTTG
C
AGCTGGCCAGCCTATGAAGGGGGCCTACCCCCCAAGGTGAACTACACCGAGGTTTCCAGGGTCTGCAAT
CTC
TGGCGCAACTATAAAGACATCCAGGACTCCTGGAAGAGTGTGCTGTCCATCCTGGACTGGTTTGTGA
GA
CACCAGGATGTACTGCAGCCGGTGGCGGGTCCTGGGCACTGGAATGACCCAGACATGCTGCTCATCGG
G
AACTTTGGCCTGAGCTTCGATGAATCCCGGGCACAAATGGCCCTGTGGACAGTGCTCGCAGCCCCCCTC
CTC
ATGTCCACGGACCTGCGTACCATCTCCCCTCAGAATATGGACATTCTTCAGAACCCACTCATGATCA
AA
ATCAATCAGGACCCCTTAGGCATCCAGGGACGCAGGATCTTAAAGAGCAAATCCCATATCGAAGTGTT
C
AAGAGGTATCTGTCTAACCAGGCCAGTGCCCTGGTTTTCTTCAGCCGCAGGACAGACATGCCTTTCCGC
TTT
CATTGCTCCCTCTTGGAACTAAACTACCCCAAAGGCAGAGTGTATGAGGGCCAGAACGTCTTCACAG
GA
GATATCTTCAGTGGTCTCCAGACTGAAGTCAACTTCACTGTGATCATCAATCCTTCGGGGGTTGTGAT
G
TGGTACCTCTATCCCATCAAAGACCTGGGGATATCCACGATGATGTCCCACTGGTGA


Translation (415 aa):
MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNIDCVEDPKNCISERLFMEMADRLAQDGWRDL
G
YVYLNIDDCWIGGRDASGRLIPDPKRFPHGIAFLADY
AHSLGLKLGIYEDMGKMTCMGYPGTTLDKVEL
D
AETFAEWKVDMLKLDGCFSSSRERAE
GYPKMAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSRVCN
L
WRNYKDIQDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDM
LLIGNFGLSFDESRAQMALWTVLAAPL
L
MSTDLRTISPQNMDILQNPLMIKINQDPLGIQGRRILK
SKSHIEVFKRYLSNQASALVFFSRRTDMPFR
F
HCSLLELNYPKGRVYE
GQNVFTGDIFSGLQTEVNFTVIINPSGVVMWYLYPIKDLGISTMMSHW



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser