NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27578.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27578.1 Public Mus musculus 15 Slc39a4 21 106 86 CCDS HistoryNCBI Gene:72027Re-query CCDS DB by CCDS ID:27578.1Re-query CCDS DB by GeneID:72027See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27578.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000073428 ENSMUSP00000073134 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073428Link to Ensembl Protein Viewer:ENSMUSP00000073134Re-query CCDS DB by Nucleotide ID:ENSMUST00000073428Re-query CCDS DB by Protein ID:ENSMUSP00000073134
Original member Current member NCBI NM_028064.2 NP_082340.1 Accepted alive Link to Nucleotide Sequence:NM_028064.2Link to Protein Sequence:NP_082340.1Re-query CCDS DB by Nucleotide ID:NM_028064Re-query CCDS DB by Protein ID:NP_082340Link to BLAST:NP_082340.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082340.1 660 Q78IQ7-1 660 100% 0 0

Chromosomal Locations for CCDS 27578.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 76612535 76612663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76612755 76612942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76613204 76613356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76613457 76613511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76613598 76613717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76613787 76613945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76614057 76614229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76614487 76614658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76614750 76614913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76615044 76615239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76615875 76616159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 76616573 76616761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1983 nt):
ATGCTCCCAAAGTCGGTCACACAGGGACTTGTGTTGGCTCTGCTGGTGGGCACAGTGGCAGTGGCCCGGC
CC
AGGAACCTGCTCAGCCTGCTCGCCTTGGGCCAGGGTGCTCTGGATCGCCTGGAACTGGACGGCCTGTT
A
AATACGCTGGTGGCCCGTGTGCACTGCACCGACGGGCCGTGTGAAAAGTGTCTGTCTGTGGAGAATGTC
TTG
GCTCTAGGCAAACCTGACAAGCCACAGCCTGCCCCAGAATCAGTCCTGGAGTCCAGACACATTATTT
AC
CTTAGTGCTGCTGCTGCCCTCTACCTTAACAACCCAGAGAAAACATGCAAGGACATCCAAGCTGGCCT
C
TTGGCCTCCCATGTGGACGATTACCTGGCCACACTGGAGAGTCCAGAGGCCATGACCCTGGGTCTGAGC
CAG
CTACTGCAGAAGATTGAGGCCCATGCTGCCAGCCAACCCACCGGGGAGAAGACCTGTGTAGATCTTC
CC
CAACTGCTGGAGGAGGCTGAGGCAGCAGGGGTTTCCAAAAGCGCCGGCCTGGTCTTGACTGCCTTGCT
G
GATCATGTCATTAATGGGTCCTGCTTCCAAGGCCTGCCTAGCCCTCAGTACTTTGTGGACTTTGTGTTC
AGG
CTACACAGTAGTGACCCTCCCAATATCACGCTGCATGAACTGGAGAATTTGATGCATCACCTTGGGG
TG
GGTGGAGAGGACCACAGTGACCATGATGACCACGGTGATCATGCTGACCACAGTCATCCGGACAGGAA
A
GCCAGCCACCAAGACTCTGAGCTCCATACTCCCCACAACAGCAACTCTAGTGTATGGGACACGCTGTGC
CTG
AGTGCCAAAGATATAATGGCTGTGTATGGGCTATCTGAAGAGGCTGGGGTGAGCCCTCAGGCCTGGG
CC
CAACTGACCCCTGCCTTGGTCCAGCAGCAGCTAAGTGGAGCCTGCAGCCCCTACCCCACTATCCGTAT
T
CAGGACCAGCTCAGTCAAACAGAGAGGTATCTCTATGGCTCGCTGGCCACCCTGCTCATCTGCCTCTGT
GCT
GTGTTCGGTCTTCTGCTGCTGACCTGTGCCAAATGCAGCACAGCCACCCACTACATCATGCAGACCT
TC
CTAAGCTTGGCTGTGGGCGCACTTACCGGCGATGCTCTTCTGCACCTGATACCCAAGGTGCTGGGACT
G
CACACACATGGTGGAGAGGGTCACACCCATGAGGAGGAGGTGGGCGTTGGTGGGCAGGCCACCTGGCGC
CTG
CTGGCTGTACTTGGAGGCTTCTACATCTTCTTCCTGTTTGAGAGCTTCTTCAACCTCTTGTTGCCCA
GG
GACCAGGATTCTGAGAAAGATGGGCCTTGTAGCCATGGTGGGCACAGCCATGGAATATCTCTGCAGCT
G
GCACCAAGCAATCTCCGACAGTCCAAACAGACCCATGAAAGCTCTCGTTCAGACTTGGTGGCAGAGGAG
ACC
CCGGAACTACTGAACCCAGAGACCCGGCGACTGAGAGCAGAGCTGAGACTGTTGCCCTATCTGATCA
CA
CTGGGCGACGCGGTACACAACTTCGCTGACGGGCTCGCTGTGGGCGCCGCCTTCTCATCCTCGTGGAA
G
ACTGGGCTGGCCACTTCATTGGCGGTGTTCTGTCATGAGCTGCCCCATGAACTCGGGGACTTCGCTGCT
CTG
CTGCATGCCGGGCTGAGTGTGAAGCGTGCGCTTTTGCTGAATCTGGCCTCAGCGCTCACAGCATTCG
CA
GGCCTCTACGTGGCTCTAGCAGTCGGAGTAGGCGAGGAGGGCGAGGCTTGGATTCTGGCGGTAGCAAC
C
GGCCTCTTCCTTTACGTGGCGCTTTGTGACATGCTCCCAGCCATGATGAATGTGCGCGACCAGCGGCCC
TGG
CTTCTTTTCCTGCTCCACAACGTGGGTCTGCTGGGCGGCTGGACCGTCCTGCTGCTGCTGTCATTGT
AC
GAAGACAACATCACCTTCTGA


Translation (660 aa):
MLPKSVTQGLVLALLVGTVAVARPRNLLSLLALGQGALDRLELDGLLNTLVARVHCTDGPCEKCLSVENV
L
ALGKPDKPQPAPESVLESRHIIYLSAAAALYLNNPEKTCKDIQAGLLASHVDDYLATLESPEAMTLGLS
Q
LLQKIEAHAASQPTGEK
TCVDLPQLLEEAEAAGVSKSAGLVLTALLDHVINGSCFQGLPSPQYFVDFVF
R
LHSSDPPNITLH
ELENLMHHLGVGGEDHSDHDDHGDHADHSHPDRKASHQDSELHTPHNSNSSVWDTLC
L
SAKDIMAVYGLSEEAGVSPQAWAQLTPALVQQQLSGACSPYPTIRIQDQLSQTE
RYLYGSLATLLICLC
A
VFGLLLLTCAKCSTATHYIMQTFLSLAVGALTGDALLHLIPK
VLGLHTHGGEGHTHEEEVGVGGQATWR
L
LAVLGGFYIFFLFESFFNLLLPRDQ
DSEKDGPCSHGGHSHGISLQLAPSNLRQSKQTHESSRSDLVAEE
T
PELLNPETRRLRA
ELRLLPYLITLGDAVHNFADGLAVGAAFSSSWKTGLATSLAVFCHELPHELGDFAA
L
LHAGLSVKRALLLNLASALTAFAGLYVALAVGVGEEGEAWILAVATGLFLYVALCDM
LPAMMNVRDQRP
W
LLFLLHNVGLLGGWTVLLLLSLYEDNITF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser