NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27540.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27540.1 Public Mus musculus 15 Ly6a 21 106 86 CCDS HistoryNCBI Gene:110454Re-query CCDS DB by CCDS ID:27540.1Re-query CCDS DB by GeneID:110454See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27540.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023248 ENSMUSP00000023248 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023248Link to Ensembl Protein Viewer:ENSMUSP00000023248Re-query CCDS DB by Nucleotide ID:ENSMUST00000023248Re-query CCDS DB by Protein ID:ENSMUSP00000023248
Original member Current member EBI,WTSI ENSMUST00000187171 ENSMUSP00000140099 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000187171Link to Ensembl Protein Viewer:ENSMUSP00000140099Re-query CCDS DB by Nucleotide ID:ENSMUST00000187171Re-query CCDS DB by Protein ID:ENSMUSP00000140099
Original member Current member EBI,WTSI ENSMUST00000187994 ENSMUSP00000140287 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000187994Link to Ensembl Protein Viewer:ENSMUSP00000140287Re-query CCDS DB by Nucleotide ID:ENSMUST00000187994Re-query CCDS DB by Protein ID:ENSMUSP00000140287
Original member Current member EBI,WTSI ENSMUST00000189068 ENSMUSP00000140638 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000189068Link to Ensembl Protein Viewer:ENSMUSP00000140638Re-query CCDS DB by Nucleotide ID:ENSMUST00000189068Re-query CCDS DB by Protein ID:ENSMUSP00000140638
Original member Current member EBI,WTSI ENSMUST00000186526 ENSMUSP00000140998 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000186526Link to Ensembl Protein Viewer:ENSMUSP00000140998Re-query CCDS DB by Nucleotide ID:ENSMUST00000186526Re-query CCDS DB by Protein ID:ENSMUSP00000140998
Original member Current member EBI,WTSI OTTMUST00000118546 OTTMUSP00000066168 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118546Link to Vega Protein Viewer:OTTMUSP00000066168Re-query CCDS DB by Nucleotide ID:OTTMUST00000118546Re-query CCDS DB by Protein ID:OTTMUSP00000066168
Original member Current member EBI,WTSI OTTMUST00000118547 OTTMUSP00000066169 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118547Link to Vega Protein Viewer:OTTMUSP00000066169Re-query CCDS DB by Nucleotide ID:OTTMUST00000118547Re-query CCDS DB by Protein ID:OTTMUSP00000066169
Original member Current member EBI,WTSI OTTMUST00000118548 OTTMUSP00000066170 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118548Link to Vega Protein Viewer:OTTMUSP00000066170Re-query CCDS DB by Nucleotide ID:OTTMUST00000118548Re-query CCDS DB by Protein ID:OTTMUSP00000066170
Original member Current member EBI,WTSI OTTMUST00000118549 OTTMUSP00000066171 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118549Link to Vega Protein Viewer:OTTMUSP00000066171Re-query CCDS DB by Nucleotide ID:OTTMUST00000118549Re-query CCDS DB by Protein ID:OTTMUSP00000066171
Original member Current member NCBI NM_001271416.1 NP_001258345.1 Accepted alive Link to Nucleotide Sequence:NM_001271416.1Link to Protein Sequence:NP_001258345.1Re-query CCDS DB by Nucleotide ID:NM_001271416Re-query CCDS DB by Protein ID:NP_001258345Link to BLAST:NP_001258345.1
Original member Current member NCBI NM_001271417.1 NP_001258346.1 Accepted alive Link to Nucleotide Sequence:NM_001271417.1Link to Protein Sequence:NP_001258346.1Re-query CCDS DB by Nucleotide ID:NM_001271417Re-query CCDS DB by Protein ID:NP_001258346Link to BLAST:NP_001258346.1
Original member Current member NCBI NM_001271418.1 NP_001258347.1 Accepted alive Link to Nucleotide Sequence:NM_001271418.1Link to Protein Sequence:NP_001258347.1Re-query CCDS DB by Nucleotide ID:NM_001271418Re-query CCDS DB by Protein ID:NP_001258347Link to BLAST:NP_001258347.1
Original member Current member NCBI NM_001271419.1 NP_001258348.1 Accepted alive Link to Nucleotide Sequence:NM_001271419.1Link to Protein Sequence:NP_001258348.1Re-query CCDS DB by Nucleotide ID:NM_001271419Re-query CCDS DB by Protein ID:NP_001258348Link to BLAST:NP_001258348.1
Original member Current member NCBI NM_001271446.1 NP_001258375.1 Accepted alive Link to Nucleotide Sequence:NM_001271446.1Link to Protein Sequence:NP_001258375.1Re-query CCDS DB by Nucleotide ID:NM_001271446Re-query CCDS DB by Protein ID:NP_001258375Link to BLAST:NP_001258375.1
Original member Current member NCBI NM_010738.3 NP_034868.1 Accepted alive Link to Nucleotide Sequence:NM_010738.3Link to Protein Sequence:NP_034868.1Re-query CCDS DB by Nucleotide ID:NM_010738Re-query CCDS DB by Protein ID:NP_034868Link to BLAST:NP_034868.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001258345.1 134 P05533 134 100% 0 0
NP_001258346.1 134 P05533 134 100% 0 0
NP_001258347.1 134 P05533 134 100% 0 0
NP_001258348.1 134 P05533 134 100% 0 0
NP_001258375.1 134 P05533 134 100% 0 0
NP_034868.1 134 P05533 134 100% 0 0

Chromosomal Locations for CCDS 27540.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 74995262 74995479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 74996452 74996568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 74997535 74997604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (405 nt):
ATGGACACTTCTCACACTACAAAGTCCTGTTTGCTGATTCTTCTTGTGGCCCTACTGTGTGCAGAAAGAG
CT
CAGGGACTGGAGTGTTACCAGTGCTATGGAGTCCCATTTGAGACTTCTTGCCCATCAATTACCTGCCC
C
TACCCTGATGGAGTCTGTGTTACTCAGGAGGCAGCAGTTATTGTGGATTCTCAAACAAGGAAAGTAAAG
AAC
AATCTTTGCTTACCCATCTGCCCTCCTAATATTGAAAGTATGGAGATCCTGGGTACTAAGGTCAACG
TG
AAGACTTCCTGTTGCCAGGAAGACCTCTGCAATGTAGCAGTTCCCAATGGAGGCAGCACCTGGACCAT
G
GCAGGGGTGCTTCTGTTCAGCCTGAGCTCAGTCCTCCTGCAGACCTTGCTCTGA


Translation (134 aa):
MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVK
N
NLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAGVLLFSLSSVLLQTLL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser