NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27421.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27421.1 Public Mus musculus 15 Kcns2 23 108 98 CCDS HistoryNCBI Gene:16539Re-query CCDS DB by CCDS ID:27421.1Re-query CCDS DB by GeneID:16539See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27421.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000072868.4 ENSMUSP00000072645.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000072868.4Link to Ensembl Protein Viewer:ENSMUSP00000072645.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000072868Re-query CCDS DB by Protein ID:ENSMUSP00000072645
Original member Current member EBI,WTSI ENSMUST00000228725.1 ENSMUSP00000153984.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000228725.1Link to Ensembl Protein Viewer:ENSMUSP00000153984.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000228725Re-query CCDS DB by Protein ID:ENSMUSP00000153984
Original member Current member NCBI NM_001271704.1 NP_001258633.1 Accepted alive Link to Nucleotide Sequence:NM_001271704.1Link to Protein Sequence:NP_001258633.1Re-query CCDS DB by Nucleotide ID:NM_001271704Re-query CCDS DB by Protein ID:NP_001258633Link to BLAST:NP_001258633.1
Original member Current member NCBI NM_181317.4 NP_851834.1 Accepted alive Link to Nucleotide Sequence:NM_181317.4Link to Protein Sequence:NP_851834.1Re-query CCDS DB by Nucleotide ID:NM_181317Re-query CCDS DB by Protein ID:NP_851834Link to BLAST:NP_851834.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001258633.1 477 O35174 477 100% 0 0
NP_851834.1 477 O35174 477 100% 0 0

Chromosomal Locations for CCDS 27421.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 34838493 34839926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1434 nt):
ATGACCCGCCAGAGCCTGTGGGATGTGTCCGATACCGACGTCGAGGATGGAGAGATCCGCATCAATGTGG
GT
GGCTTCAAGAGACGGCTGCGTTCCCATACGCTGCTGCGCTTCCCTGAGACACGCCTGGGCCGTCTGCT
C
CTCTGCCACTCGCGAGAGGCCATTCTGGAACTCTGCGATGACTACGATGACGTTCAGCGTGAGTTCTAC
TTC
GACCGTAACCCCGAGCTCTTCCCCTATGTGTTGCATTTCTACCACACCGGCAAGCTTCACGTCATGG
CT
GAGCTGTGCGTCTTCTCCTTCAGCCAGGAGATCGAGTACTGGGGTATCAATGAGTTCTTCATCGACTC
T
TGCTGCAGCTATAGCTATCACGGCCGCAAAGTGGAACCTGAGCAGGAGAAATGGGACGAGCAGAGTGAC
CAG
GAAAGCACCACTTCCTCCTTCGATGAGATCTTGGCCTTCTATAATGATGCTTCCAAGTTCGATGGGC
AA
CCCCTGGGCAACTTCCGCAGGCAGCTGTGGCTGGCGTTGGACAACCCAGGCTACTCAGTCCTAAGCAG
G
GTCTTCAGTGTCCTTTCCATCTTGGTGGTGTTGGGCTCCATCATCACCATGTGCCTCAATAGCCTGCCA
GAC
TTCCAAATCCCTGATAGCCAGGGTAACCCCGGTGAAGACCCCAGGTTCGAAATTGTGGAGCACTTTG
GC
ATTGCTTGGTTCACATTTGAGTTGGTGGCCAGGTTTGCTGTGGCCCCTGACTTTCTTAAGTTCTTCAA
G
AATGCTCTAAACCTTATTGATCTCATGTCCATTGTCCCATTTTACATAACTCTAGTGGTGAACCTGGTG
GTG
GAGAGTTCTCCTACCTTGGCTAACTTGGGCAGGGTGGCTCAAGTCCTGAGGCTAATGAGGATCTTCC
GA
ATTCTCAAGCTGGCCAGACACTCCACTGGCCTCCGCTCCTTGGGAGCCACCCTGAAGTACAGCTACAA
G
GAAGTGGGGTTGCTCTTGCTCTACCTCTCAGTGGGGATTTCCATCTTCTCTGTGGTGGCCTACACCATT
GAA
AAGGAGGAGAACGAAGGCCTGGCCACCATCCCTGCCTGCTGGTGGTGGGCCACTGTCAGTATGACCA
CA
GTTGGGTACGGAGATGTGGTCCCAGGGACAACAGCTGGGAAGTTGACTGCCTCTGCCTGCATCTTGGC
A
GGCATCCTGGTGGTGGTCTTGCCCATCACTTTGATCTTCAATAAGTTCTCCCATTTCTATCGGCGCCAA
AAG
CAACTTGAGAGTGCTATGCGCAGCTGTGACTTTGGAGATGGAATGAAAGAGGTCCCTTCGGTCAATT
TA
AGGGACTACTATGCTCATAAAGTTAAGTCCCTCATGGCAAGTCTGACAAACATGAGTAGGAGTTCACC
T
AGTGAACTGAGTTTAGATGATTCTCTACATTAG


Translation (477 aa):
MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFY
F
DRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSD
Q
ESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLP
D
FQIPDSQGNPGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLV
V
ESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTI
E
KEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ
K
QLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLDDSLH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser