NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27271.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27271.1 Public Mus musculus 14 Sucla2 21 106 86 CCDS HistoryNCBI Gene:20916Re-query CCDS DB by CCDS ID:27271.1Re-query CCDS DB by GeneID:20916See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27271.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022706 ENSMUSP00000022706 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022706Link to Ensembl Protein Viewer:ENSMUSP00000022706Re-query CCDS DB by Nucleotide ID:ENSMUST00000022706Re-query CCDS DB by Protein ID:ENSMUSP00000022706
Original member Current member EBI,WTSI ENSMUST00000160507 ENSMUSP00000123765 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160507Link to Ensembl Protein Viewer:ENSMUSP00000123765Re-query CCDS DB by Nucleotide ID:ENSMUST00000160507Re-query CCDS DB by Protein ID:ENSMUSP00000123765
Original member Current member EBI,WTSI OTTMUST00000089057 OTTMUSP00000048616 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000089057Link to Vega Protein Viewer:OTTMUSP00000048616Re-query CCDS DB by Nucleotide ID:OTTMUST00000089057Re-query CCDS DB by Protein ID:OTTMUSP00000048616
Original member Current member EBI,WTSI OTTMUST00000089075 OTTMUSP00000048627 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000089075Link to Vega Protein Viewer:OTTMUSP00000048627Re-query CCDS DB by Nucleotide ID:OTTMUST00000089075Re-query CCDS DB by Protein ID:OTTMUSP00000048627
Original member NCBI NM_011506.3 NP_035636.1 Updated not alive Link to Nucleotide Sequence:NM_011506.3Link to Protein Sequence:NP_035636.1Re-query CCDS DB by Nucleotide ID:NM_011506Re-query CCDS DB by Protein ID:NP_035636
Current member NCBI NM_011506.4 NP_035636.1 Accepted alive Link to Nucleotide Sequence:NM_011506.4Link to Protein Sequence:NP_035636.1Re-query CCDS DB by Nucleotide ID:NM_011506Re-query CCDS DB by Protein ID:NP_035636Link to BLAST:NP_035636.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035636.1 463 Q9Z2I9 463 100% 0 0

Chromosomal Locations for CCDS 27271.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 73552808 73552897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73560441 73560621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73568634 73568733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73568862 73569024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73579356 73579484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73581679 73581817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73590757 73590918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73591010 73591152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73592632 73592752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73593677 73593765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 73595374 73595448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1392 nt):
ATGGCGGCGTCCATGTTCTACGGCCGGCAGTTGGCCGCGGCCGCCCTGAGGAGCCACCGGCCGCAGACTA
CG
CTGCGAGCCGCCGCCCAGGTTCTGGGAAATTCTGGCTTGTTTAACAAGCATGGACTACAAGTGCAGCA
G
CAGCAGCAGAGGACCCTTTCGCTGCATGAATACTTGAGTATGGAGTTATTGCAGGAAGCGGGTGTCTCT
GTT
CCCAAAGGCTTCGTGGCAAAGTCATCCGATGAAGCTTACGCAATTGCCAAAAAATTAGGATCAAAGG
AT
GTTGTGATAAAGGCACAGGTTTTGGCTGGCGGCAGAGGAAAAGGAACATTTACAAGTGGCCTCAAAGG
A
GGAGTGAAGATTGTTTTCTCTCCAGAAGAAGCAAAAGCTGTTTCCTCACAGATGATTGGGCAAAAATTG
ATT
ACCAAGCAAACTGGAGAAAAGGGCAGAATATGCAATCAAGTTTTGGTCTGTGAGCGCAAATATCCCA
GG
AGAGAATACTACTTTGCAATAACAATGGAGAGGTCATTTCAAGGTCCTGTACTGATAGGAAGTGCACA
A
GGTGGTGTTAACATTGAAGATGTGGCTGCCGAGAACCCTGAAGCCATTGTAAAGGAGCCTATTGATATA
GTG
GAGGGCATCAAAAAGGAACAAGCCGTGACACTTGCACAGAAGATGGGATTTCCTTCTAACATTGTGG
AC
TCTGCAGCAGAAAACATGATCAAGCTTTATAATCTTTTTCTGAAGTATGATGCAACTATGGTAGAAAT
A
AACCCAATGGTAGAAGATTCTGACGGAAAGGTGTTGTGCATGGATGCAAAGATCAATTTTGATTCAAAT
TCA
GCCTACCGCCAGAAGAAGATCTTTGATCTTCAGGACTGGAGTCAGGAAGACGAAAGGGACAAAGAAG
CA
GCTAATGCAGATATTAACTACATCGGCCTCGATGGGAGCATAGGATGTCTAGTAAATGGTGCTGGCTT
G
GCTATGGCCACAATGGATATAATAAAACTACACGGAGGGACTCCAGCCAACTTTCTTGATGTTGGTGGA
GGC
GCCACAGTCCAGCAAGTAACAGAAGCGTTTAAACTCATCACTTCAGATAAAAAGGTGCAGGCTATTC
TG
GTCAACATTTTTGGAGGAATCATGAGATGTGATGTTATTGCACAAGGAATAGTCATGGCAGTAAAGGA
T
TTAGAAATCAGAATACCTGTTGTGGTGCGGTTACAAGGTACACGAGTTGATGATGCTAAGGCACTAATA
GCA
GACAGTGGTCTTAAAATCCTTGCTTGTGATGATTTGGATGAAGCTGCTAAAATGGTTGTAAAGCTCT
CT
GAAATAGTGACCTTAGCCAAAGAAGCCCATGTGGATGTGAAGTTTCAATTGCCAATATGA


Translation (463 aa):
MAASMFYGRQLAAAALRSHRPQTTLRAAAQVLGNSGLFNKHGLQVQQQQQRTLSLHEYLSMELLQEAGVS
V
PKGFVAKSSDEAYAIAKKL
GSKDVVIKAQVLAGGRGKGTFTSGLKGGVKIVFSPEEAKAVSSQMIGQKL
I
TKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQ
GPVLIGSAQGGVNIEDVAAENPEAIVKEPIDI
V
EGIKKEQAVT
LAQKMGFPSNIVDSAAENMIKLYNLFLKYDATMVEINPMVEDSDGKVLCMDAKINFDSN
S
AYRQKKIFDLQDWSQEDERDKEAANADINYIGLDGSIGCL
VNGAGLAMATMDIIKLHGGTPANFLDVGG
G
ATVQQVTEAFKLITSDKK
VQAILVNIFGGIMRCDVIAQGIVMAVKDLEIRIPVVVRLQGTRVDDAKALI
A
DSGLKILACDDLDEAAKM
VVKLSEIVTLAKEAHVDVKFQLPI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser