NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27085.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27085.1 Public Mus musculus 14 Olfr49 21 106 86 CCDS HistoryNCBI Gene:18348Re-query CCDS DB by CCDS ID:27085.1Re-query CCDS DB by GeneID:18348See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27085.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000059996 ENSMUSP00000054361 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000059996Link to Ensembl Protein Viewer:ENSMUSP00000054361Re-query CCDS DB by Nucleotide ID:ENSMUST00000059996Re-query CCDS DB by Protein ID:ENSMUSP00000054361
Original member Current member EBI,WTSI OTTMUST00000134055 OTTMUSP00000071167 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000134055Link to Vega Protein Viewer:OTTMUSP00000071167Re-query CCDS DB by Nucleotide ID:OTTMUST00000134055Re-query CCDS DB by Protein ID:OTTMUSP00000071167
Original member Current member NCBI NM_010991.2 NP_035121.1 Accepted alive Link to Nucleotide Sequence:NM_010991.2Link to Protein Sequence:NP_035121.1Re-query CCDS DB by Nucleotide ID:NM_010991Re-query CCDS DB by Protein ID:NP_035121Link to BLAST:NP_035121.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035121.1 313 Q9Z1V0 313 100% 0 0

Chromosomal Locations for CCDS 27085.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 54281952 54282893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (942 nt):
ATGGCGAACAGCACTACTGTTACTGAGTTTATTTTGCTGGGGCTGTCAGATGCCTGTGAGCTGCAGGTGC
TC
ATATTCCTGGGCTTTCTCCTGACCTACTTCCTCATTCTGCTGGGAAACTTCCTCATCATCTTCATCAC
C
CTTGTGGACAGGCGCCTTTACACCCCCATGTATTACTTCCTCCGCAACTTTGCCATGCTGGAGATCTGG
TTC
ACCTCTGTCATCTTCCCCAAGATGCTAACCAACATCATCACAGGACATAAGACCATCTCCCTACTAG
GT
TGTTTCCTCCAAGCATTCCTCTATTTCTTCCTTGGCACCACTGAGTTCTTTCTACTGGCAGTGATGTC
C
TTTGACAGGTATGTGGCCATTTGTAACCCTTTGCGTTATGCCACCATTATGAGCAAAAGAGTCTGTGTC
CAG
CTTGTGTTTTGCTCATGGATGTCTGGATTGCTTCTCATCATAGTTCCTAGTTCAATTGTATTTCAGC
AG
CCGTTCTGTGGCCCAAACATCATTAATCATTTCTTCTGTGACAACTTTCCACTTATGGAACTCATATG
T
GCAGATACCAGCCTGGTAGAGTTCCTGGGTTTTGTTATTGCCAATTTCAGCCTCCTGGGCACTCTGGCT
GTG
ACTGCCACCTGCTATGGCCACATTCTCTATACCATTCTACACATTCCTTCAGCCAAGGAGAGGAAGA
AA
GCCTTCTCAACTTGCTCCTCTCATATTATTGTGGTGTCTCTCTTCTATGGCAGCTGTATCTTCATGTA
T
GTCCGGTCTGGCAAGAATGGACAGGGGGAGGATCATAACAAGGTGGTGGCATTGCTCAACACTGTAGTG
ACA
CCCACACTCAACCCCTTCATCTACACTCTGAGGAACAAGCAGGTGAAGCAGGTATTTAGGGAACACG
TA
AGCAAGTTCCAAAAGTTCAGCCAGACATGA


Translation (313 aa):
MANSTTVTEFILLGLSDACELQVLIFLGFLLTYFLILLGNFLIIFITLVDRRLYTPMYYFLRNFAMLEIW
F
TSVIFPKMLTNIITGHKTISLLGCFLQAFLYFFLGTTEFFLLAVMSFDRYVAICNPLRYATIMSKRVCV
Q
LVFCSWMSGLLLIIVPSSIVFQQPFCGPNIINHFFCDNFPLMELICADTSLVEFLGFVIANFSLLGTLA
V
TATCYGHILYTILHIPSAKERKKAFSTCSSHIIVVSLFYGSCIFMYVRSGKNGQGEDHNKVVALLNTVV
T
PTLNPFIYTLRNKQVKQVFREHVSKFQKFSQT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser