NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26835.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26835.1 Public Mus musculus 14 Thrb 21 106 86 CCDS HistoryNCBI Gene:21834Re-query CCDS DB by CCDS ID:26835.1Re-query CCDS DB by GeneID:21834See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26835.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022304 ENSMUSP00000022304 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022304Link to Ensembl Protein Viewer:ENSMUSP00000022304Re-query CCDS DB by Nucleotide ID:ENSMUST00000022304Re-query CCDS DB by Protein ID:ENSMUSP00000022304
Original member Current member EBI,WTSI OTTMUST00000056280 OTTMUSP00000027025 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000056280Link to Vega Protein Viewer:OTTMUSP00000027025Re-query CCDS DB by Nucleotide ID:OTTMUST00000056280Re-query CCDS DB by Protein ID:OTTMUSP00000027025
Original member Current member NCBI NM_009380.3 NP_033406.1 Accepted alive Link to Nucleotide Sequence:NM_009380.3Link to Protein Sequence:NP_033406.1Re-query CCDS DB by Nucleotide ID:NM_009380Re-query CCDS DB by Protein ID:NP_033406Link to BLAST:NP_033406.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033406.1 475 P37242-2 475 100% 0 0

Chromosomal Locations for CCDS 26835.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 17981877 17982201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 18002528 18002628 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 18008569 18008716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 18011065 18011270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 18026637 18026783 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 18030143 18030401 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 18033425 18033666 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1428 nt):
ATGAACTACTGTATGCCAGAGGTACACGAAGTGTGCCCAGCTGCCAGCAGCAACTGCTACATGCAGGTCA
CT
GACTACCTCGCATATCTGGAAGACAGTCCGGCTCTCAGTGGTCGTGATGTCCAAGCTGTGCCCAGTAG
C
AGCATATATATGGAACAGGCCTGGGCAGTGAATCAGCCTTATACCTGTAGTTACCCTGGAAACCTGTTT
AAA
AGCAAGGACTCTGACTTGGACATGGCCCTCAGTCAGTCCAGCCAGCCTGCACATCTCCCTGAAGAAA
AG
CCTTTTCCTCAAGTGCAGTCGCCACCGCACTCACAAAAAAAAGGGTATATCCCCAGCTATTTAGACAA
A
GATGAGCTCTGTGTAGTGTGTGGGGACAAAGCCACAGGGTACCACTATCGCTGCATCACCTGTGAAGGC
TGC
AAGGGCTTCTTTAGAAGAACCATTCAGAAAAGTCTCCATCCATCTTATTCCTGTAAATATGAAGGAA
AG
TGCATCATAGACAAAGTCACCCGCAACCAGTGCCAGGAATGTCGCTTTAAGAAATGCATCTATGTTGG
C
ATGGCAACAGACTTGGTGCTGGATGACAGCAAGAGGCTAGCCAAGCGGAAGCTTATAGAGGAGAACCGT
GAG
AAGAGGCGGCGGGAAGAGCTACAGAAATCAATTGGGCACAAGCCAGAACCCACGGATGAGGAGTGGG
AG
CTCATCAAGACAGTCACTGAGGCCCACGTGGCCACCAATGCCCAGGGCAGCCACTGGAAGCAGAAGCG
G
AAATTCCTGCCAGAAGACATTGGACAAGCACCCATCGTGAATGCCCCAGAAGGTGGCAAGGTTGACCTG
GAA
GCCTTCAGTCATTTTACAAAAATCATCACACCAGCAATTACCAGAGTGGTGGATTTTGCCAAAAAGT
TG
CCCATGTTTTGTGAGCTGCCATGTGAAGACCAGATCATCCTCCTCAAAGGCTGCTGCATGGAGATCAT
G
TCCCTTCGAGCTGCTGTGCGCTATGACCCAGACAGCGAGACTCTAACTTTGAATGGGGAAATGGCAGTG
ACA
CGAGGCCAGCTGAAAAATGGGGGCCTTGGGGTGGTTTCAGATGCCATCTTTGACCTGGGCATGTCTC
TG
TCATCTTTCAACCTGGATGACACTGAAGTCGCCCTGCTTCAGGCCGTCCTGCTAATGTCTTCAGATCG
C
CCAGGGCTAGCCTGTGTTGAGAGAATAGAGAAATACCAAGACAGTTTCCTGTTGGCCTTTGAACACTAT
ATC
AATTACCGGAAGCACCATGTGACACACTTTTGGCCCAAACTCCTGATGAAGGTGACAGACCTGCGGA
TG
ATTGGAGCTTGCCATGCCAGCCGCTTCCTCCACATGAAGGTGGAGTGCCCCACTGAGCTCTTCCCGCC
T
CTGTTCTTAGAAGTATTTGAGGACTAA


Translation (475 aa):
MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIYMEQAWAVNQPYTCSYPGNLF
K
SKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKK
GYIPSYLDKDELCVVCGDKATGYHYRCITCEG
C
K
GFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENR
E
KRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFL
PEDIGQAPIVNAPEGGKVDL
E
AFSHFTKIITPAITRVVDFAKKLPMFCE
LPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAV
T
RGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSS
DRPGLACVERIEKYQDSFLLAFEHY
I
NYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser