NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26664.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26664.1 Public Mus musculus 13 Mef2c 21 106 86 CCDS HistoryNCBI Gene:17260Re-query CCDS DB by CCDS ID:26664.1Re-query CCDS DB by GeneID:17260See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26664.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000198199 ENSMUSP00000143742 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000198199Link to Ensembl Protein Viewer:ENSMUSP00000143742Re-query CCDS DB by Nucleotide ID:ENSMUST00000198199Re-query CCDS DB by Protein ID:ENSMUSP00000143742
Original member Current member EBI,WTSI OTTMUST00000136986 OTTMUSP00000072204 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000136986Link to Vega Protein Viewer:OTTMUSP00000072204Re-query CCDS DB by Nucleotide ID:OTTMUST00000136986Re-query CCDS DB by Protein ID:OTTMUSP00000072204
Original member Current member NCBI NM_025282.3 NP_079558.1 Accepted alive Link to Nucleotide Sequence:NM_025282.3Link to Protein Sequence:NP_079558.1Re-query CCDS DB by Nucleotide ID:NM_025282Re-query CCDS DB by Protein ID:NP_079558Link to BLink:NP_079558.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079558.1 432 Q8CFN5-4 432 100% 0 0

Chromosomal Locations for CCDS 26664.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 83575677 83575730 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83592778 83592981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83625470 83625607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83633055 83633241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83635422 83635469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83652814 83652986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83655507 83655636 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83656217 83656352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 83662403 83662631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1299 nt):
ATGGGGAGAAAAAAGATTCAGATTACGAGGATAATGGATGAGCGTAACAGACAGGTGACTTTTACGAAGA
GG
AAATTTGGATTGATGAAGAAGGCTTATGAGCTGAGCGTGCTGTGCGACTGTGAGATTGCACTGATCAT
C
TTCAACAGCACCAACAAGCTGTTCCAGTACGCCAGCACTGACATGGATAAGGTGTTGCTCAAGTACACC
GAG
TACAACGAGCCGCACGAGAGCCGGACAAACTCAGACATTGTGGAGGCATTGAACAAGAAAGAAAACA
AA
GGCTCTGAAAGCCCCGATCCTGACTCCTCTTATGCACTCACCCCACGCACTGAAGAAAAATACAAAAA
A
ATTAATGAAGAATTTGATAATATGATCAAGAGTCATAAAATTCCTGCTGTTCCACCTCCCAGCTTTGAG
ATG
CCAGTTACCATCCCAGTGTCCAGCCATAACAGTTTGGTGTACAGCAATCCTGTCAGCACACTGGGAA
AC
CCCAATCTTCTGCCACTGGCCCACCCGTCTCTGCAGAGGAATAGTATGTCTCCTGGTGTAACACATAG
A
CCTCCAAGTGCAGGTAACACAGGCGGTCTGATGGGCGGAGATCTGACATCCGGTGCAGGCACCAGCGCA
G
GG
AATGGATACGGCAACCCCCGGAACTCACCAGGCCTGCTGGTCTCACCTGGTAACCTGAACAAGAATA
TA
CAAGCCAAATCTCCTCCCCCTATGAATCTAGGAATGAATAATCGTAAGCCAGATCTCCGCGTTCTTAT
C
CCACCTGGCAGCAAGAACACGATGCCATCAGTGAATCAAAGGATAAATAACTCCCAGTCGGCTCAGTCA
TTG
GCTACCCCGGTGGTTTCCGTAGCAACTCCTACTTTACCAGGACAAGGAATGGGAGGATATCCATCAG
CC
ATTTCAACAACATATGGTACTGAGTACTCTCTGAGTAGCGCAGATCTGTCATCTCTGTCTGGCTTCAA
C
ACTGCCAGTGCGCTCCACCTCGGCTCTGTAACTGGCTGGCAGCAGCAGCACCTACATAACATGCCGCCA
TCT
GCCCTCAGTCAGTTGGGAGACCGTACCACCACCCCTTCGAGATACCCACAACACACCACGCGCCACG
AG
GCGGGGAGGTCTCCTGTTGACAGCTTGAGCAGCTGTAGCAGTTCCTACGATGGGAGCGACCGAGAGGA
T
CACCGGAACGAATTCCACTCCCCCATTGGACTCACCAGACCTTCGCCGGACGAAAGGGAAAGTCCTTCA
GTC
AAGCGCATGCGACTCTCTGAAGGATGGGCAACATGA


Translation (432 aa):
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT
E
YNEPHESRTNSDIVE
ALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIKSHKIPAVPPPSFE
M
PVTIPVSSHNSLVYSNPVSTLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNT
GGLMGGDLTSGAGTSA
G
NGYGNPRNSPGLLVSPGNLNKNIQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQS
L
ATPVVSVATPTLPGQGMGGYPSAISTTYGT
EYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
S
ALSQL
GDRTTTPSRYPQHTTRHEAGRSPVDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPS
V
KRMRLSEGWAT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser