NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26654.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26654.1 Public Mus musculus 13 Rfesd 21 106 86 CCDS HistoryNCBI Gene:218341Re-query CCDS DB by CCDS ID:26654.1Re-query CCDS DB by GeneID:218341See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 26654.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000050997 ENSMUSP00000055763 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000050997Link to Ensembl Protein Viewer:ENSMUSP00000055763Re-query CCDS DB by Nucleotide ID:ENSMUST00000050997Re-query CCDS DB by Protein ID:ENSMUSP00000055763
Original member Current member EBI,WTSI ENSMUST00000167271 ENSMUSP00000130366 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167271Link to Ensembl Protein Viewer:ENSMUSP00000130366Re-query CCDS DB by Nucleotide ID:ENSMUST00000167271Re-query CCDS DB by Protein ID:ENSMUSP00000130366
Original member Current member EBI,WTSI ENSMUST00000179078 ENSMUSP00000136314 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179078Link to Ensembl Protein Viewer:ENSMUSP00000136314Re-query CCDS DB by Nucleotide ID:ENSMUST00000179078Re-query CCDS DB by Protein ID:ENSMUSP00000136314
Original member Current member NCBI NM_001131068.1 NP_001124540.1 Accepted alive Link to Nucleotide Sequence:NM_001131068.1Link to Protein Sequence:NP_001124540.1Re-query CCDS DB by Nucleotide ID:NM_001131068Re-query CCDS DB by Protein ID:NP_001124540Link to BLAST:NP_001124540.1
Original member Current member NCBI NM_001131069.1 NP_001124541.1 Accepted alive Link to Nucleotide Sequence:NM_001131069.1Link to Protein Sequence:NP_001124541.1Re-query CCDS DB by Nucleotide ID:NM_001131069Re-query CCDS DB by Protein ID:NP_001124541Link to BLAST:NP_001124541.1
Original member Current member NCBI NM_178916.5 NP_849247.3 Accepted alive Link to Nucleotide Sequence:NM_178916.5Link to Protein Sequence:NP_849247.3Re-query CCDS DB by Nucleotide ID:NM_178916Re-query CCDS DB by Protein ID:NP_849247Link to BLAST:NP_849247.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001124540.1 157 Q8K2P6-1 157 100% 0 0
NP_001124541.1 157 Q8K2P6-1 157 100% 0 0
NP_849247.3 157 Q8K2P6-1 157 100% 0 0

Chromosomal Locations for CCDS 26654.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 76002825 76003088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 76007983 76008017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 76008111 76008285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (474 nt):
ATGGACCCTGAAATCTCTGAACAAGATGAGGAAAAGAAGAAATATACTTCCGTCTGTGTTGGCAGAGAAG
AG
GACATTAGAAAATCAGAAAGAATGACAGCTGTTGTCCATGACAGAGAAGTGGTCATTTTCTACCACAA
A
GGGGAATATCATGCTATGGACATTCGCTGTTACCATTCTGGAGGGCCCTTACACTTGGGAGAAATTGAG
GAT
TTCAATGGACAATCATGTATAGTTTGCCCCTGGCATAAATATAAAATCACTTTGGCAACAGGAGAAG
GA
TTATACCAGTCTATAAATCCTAAAGACCCATCAGCAAAACCCAAGTGGTGTTCCAAAGGAGTAAAGCA
A
AGGATTCACACCGTGAAGGTGGATAACGGCAATATTTATGTGACACTTTCTAAGGAACCATTTAAATGT
GAC
TCTGACTATTATGCCACTGGAGAATTCAAAGTGATTCAGAGTTCCTCCTGA


Translation (157 aa):
MDPEISEQDEEKKKYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGEIE
D
FNGQSCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIHTVKVDNGNIYVTLSKEPFKC
D
SDYYATGEFKVIQSSS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser