NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26647.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26647.1 Public Mus musculus 13 Erap1 21 106 86 CCDS HistoryNCBI Gene:80898Re-query CCDS DB by CCDS ID:26647.1Re-query CCDS DB by GeneID:80898See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 26647.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000169114 ENSMUSP00000133166 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169114Link to Ensembl Protein Viewer:ENSMUSP00000133166Re-query CCDS DB by Nucleotide ID:ENSMUST00000169114Re-query CCDS DB by Protein ID:ENSMUSP00000133166
Original member Current member NCBI NM_030711.4 NP_109636.1 Accepted alive Link to Nucleotide Sequence:NM_030711.4Link to Protein Sequence:NP_109636.1Re-query CCDS DB by Nucleotide ID:NM_030711Re-query CCDS DB by Protein ID:NP_109636Link to BLink:NP_109636.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_109636.1 930 Q9EQH2 930 100% 0 0

Chromosomal Locations for CCDS 26647.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 74646224 74646714 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74657633 74657771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74660270 74660404 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74662309 74662429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74663409 74663563 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74664109 74664222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74666099 74666230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74666444 74666575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74666718 74666789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74667958 74668112 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74669400 74669479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74671308 74671491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74672744 74672900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74673595 74673779 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74674622 74674783 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74675263 74675403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74675825 74675906 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 74690574 74690729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2793 nt):
ATGCCCTCTCTTCTTCCCCTAGTATTGACATTTTTATCTGTGTCATCTCCTTCTTGGTGTCAGAACAGTG
AT
ATAGAATCTCTAAAAGCTAGTAATGGAGACTCATTCCCTTGGAATAATATGCGACTTCCTGAGTATAT
G
ACCCCGATTCATTATGATCTCATGATCCATGCAAACCTCAGCACTCTGACTTTCTGGGGAAAAACAGAA
GTA
GAAATCATAGCTAGCCGGCCCACCAGCACCATTATTATGCATAGTCACCACCTGCAAATATCTAAGG
CC
ACCCTCAGAAGAGGAGCTGGAGAGATGCTGTCTGAAGAACCACTGAAGGTCCTGGAATATCCTGCTCA
T
GAGCAAGTTGCACTGCTGGCTGCCCAGCCGCTTCTTGCTGGGTCCCTGTACACAGTTATCATCGACTAT
GCT
GCCAACCTGTCTGAGAGTTTCCATGGATTCTATAAGAGCACCTACAGAACACAGGAAGGTGAAATGA
G
A
ATACTTGCAGCAACACAGTTTGAACCCACAGCTGCTAGAATGGCTTTTCCCTGCTTTGATGAACCTGC
C
CTCAAGGCAAGTTTTTCCATCAAGATAAAGAGGGATCCAAGGCACCTGGCCATCTCCAACATGCCCCTG
GTG
AAATCTGTGAATGTTGCTGAAGGACTCATAGAAGACCATTTTGACATCACTGTGAAGATGAGTACCT
AC
CTAGTGGCCTTCATCATTTCTGATTTTAAGTCTGTGAGCAAGATGACTAAGAGTGGAGTCAAGGTTTC
T
GTGTATGCTGTGCCAGACAAGATAAATCAAGCCGATTATGCTCTGGATGCTGCAGTGACTCTTCTAGAG
TTT
TATGAGGATTATTTCAACATTCCATATCCTTTACCCAAGCAAGATCTTGCTGCAATCCCAGACTTTC
AG
TCTGGTGCTATGGAAAACTGGGGACTGACCACATACAGAGAGTCCTCTCTGTTATACGATAAAGAAAA
G
TCTTCTGCATCTAGTAAGCTTGGCATCACAATGATTGTGTCCCATGAACTGGCTCACCAGTGGTTCGGG
AAC
CTGGTCACCATGGAATGGTGGAATGACCTTTGGCTCAATGAAGGATTTGCCAAATTTATGGAGTTTG
TG
TCTGTCACTGTGACCCATCCTGAACTAAAAGTTGAAGACTATTTCTTTGGCAAGTGTTTTAATGCAAT
G
GAAGTTGATGCATTAAACTCCTCTCACCCTGTATCCACACCTGTGGAGAATCCTGCGCAGATTCGGGAG
ATG
TTTGATGATGTTTCTTATGAAAAGGGAGCTTGTATTCTGAATATGCTAAGAGATTATCTGAGTGCAG
AT
ACATTTAAAAGAGGAATTGTACAGTATCTCCAAAAGTATAGTTATAAAAACACAAAAAACGAGGACCT
G
TGGAATAGCATGATGCATATTTGCCCTACAGATGGCACACAAACAATGGATGGCTTCTGCTCTAGAAGC
CAA
CACTCATCATCAACCTCACACTGGCGTCAGGAGGTTGTAGATGTAAAGACCATGATGAACACATGGA
CA
CTGCAGAAGGGCTTTCCTCTGATAACCATCACTGTGAGTGGGCGGAATGTGCACATGAAGCAAGAACA
C
TACATGAAGGGTTCAGAACGCTTCCCAGAGACTGGGTATTTGTGGCATGTTCCACTGACATTCATTACC
AGC
AAATCAGACTCAGTCCAGAGATTTTTGCTGAAGACAAAGACAGATGTGCTCATCCTCCCAGAAGCAG
TG
CAGTGGATCAAATTTAACGTGGGAATGAATGGCTATTACATTGTGCATTACGCGGATGATGGATGGGC
T
TCTCTGAGTGGCCTTTTAAAAGAAGCGCACACAACAATCAGCAGTAATGATCGGGCAAGTCTCATCAAC
AAT
GCATTTCAGCTGGTCAGCATTGAAAAGTTATCAATAGAAAAAGCCCTGGATTTAACCCTGTACTTGA
AA
AATGAAACTGAAATTATGCCCATATTCCAAGCTTTGAATGAACTCATACCTATGTATAAGTTAATGGA
G
AAAAGAGATATGATTGAGGTGGAAACTCAATTTAAGGACTTCCTTCTCAAGTTGCTGAAGGACCTTATT
GAT
AAGCAGACTTGGACAGATGAAGGCTCTGTCTCAGAGAGGATGCTCAGGAGCCAGCTCCTCCTCCTCG
CA
TGTGTGCGCAATTATCAGCCCTGTGTGCAGAGGGCAGAGCGCTATTTCAGAGAGTGGAAGTCATCTAA
T
GGAAACATGAGCATCCCTATTGATGTGACCTTGGCTGTGTTTGCTGTCGGGGCCCAAAACACAGAAGGC
TGG
GATTTTCTTTATAGTAAATATCAGTCTTCTTTGTCTAGTACTGAGAAAAGCCAAATTGAATTTTCCC
TC
TGTACAAGCAAAGATCCAGAAAAACTTCAGTGGCTTCTAGATCAAAGTTTTAAGGGAGAGATAATAAA
A
ACTCAGGAATTTCCACATATTCTCACACTCATTGGCAGAAACCCAGTGGGTTATCCATTGGCCTGGAAG
TTT
CTGAGGGAAAATTGGAATAAGCTTGTACAGAAATTTGAACTTGGCTCATCGTCCATAGCTCACATGG
TA
ATGGGAACAACAGACCAGTTTTCCACCAGAGCACGTCTTGAAGAGGTAAAAGGATTCTTCAGTTCCTT
G
AAAGAAAACGGTTCTCAGCTCCGTTGTGTTCAACAAACCATTGAGACCATTGAAGAAAACATACGATGG
ATG
GATAAGAATTTTGATAAAATAAGACTGTGGCTGCAAAAAGAAAAGCCAGAGTTGCTGTGA


Translation (930 aa):
MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPEYMTPIHYDLMIHANLSTLTFWGKTE
V
EIIASRPTSTIIMHSHHLQISKATLRRGAGEMLSEEPLKVLEYPAHEQVALLAAQPLLAGSLYTVIIDY
A
ANLSESFHGFYKSTYRTQEGEM
RILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPL
V
KSVNVAEGLIEDHFDITVKMSTYLVAFIISDFKSVSKMTKSGVK
VSVYAVPDKINQADYALDAAVTLLE
F
YEDYFNIPYPLPKQ
DLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIVSHELAHQWFG
N
LVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKV
EDYFFGKCFNAMEVDALNSSHPVSTPVENPAQIRE
M
FDDVSYEK
GACILNMLRDYLSADTFKRGIVQYLQKYSYKNTKNEDLWNSMMHICPTDGTQTMDGFCSRS
Q
HSSSTS
HWRQEVVDVKTMMNTWTLQKGFPLITITVSGRNVHMKQEHYMKGSERFPETGYLWHVPLTFIT
S
KSDSVQRFLLKTKT
DVLILPEAVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLIN
N
AFQLV
SIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLKLLKDLI
D
KQTWTDEGSVSERMLRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNM
SIPIDVTLAVFAVGAQNTEG
W
DFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQ
WLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWK
F
LRENWNKLVQ
KFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRW
M
DKNFDKIRLWLQKEKPELL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser