NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26550.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26550.1 Public Mus musculus 13 B4galt7 21 106 86 CCDS HistoryNCBI Gene:218271Re-query CCDS DB by CCDS ID:26550.1Re-query CCDS DB by GeneID:218271See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26550.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000064701 ENSMUSP00000068532 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064701Link to Ensembl Protein Viewer:ENSMUSP00000068532Re-query CCDS DB by Nucleotide ID:ENSMUST00000064701Re-query CCDS DB by Protein ID:ENSMUSP00000068532
Original member Current member EBI,WTSI OTTMUST00000068644 OTTMUSP00000034749 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000068644Link to Vega Protein Viewer:OTTMUSP00000034749Re-query CCDS DB by Nucleotide ID:OTTMUST00000068644Re-query CCDS DB by Protein ID:OTTMUSP00000034749
Original member Current member NCBI NM_146045.2 NP_666157.1 Accepted alive Link to Nucleotide Sequence:NM_146045.2Link to Protein Sequence:NP_666157.1Re-query CCDS DB by Nucleotide ID:NM_146045Re-query CCDS DB by Protein ID:NP_666157Link to BLink:NP_666157.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_666157.1 327 Q8R087-1 327 100% 0 0

Chromosomal Locations for CCDS 26550.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 55600143 55600192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55604020 55604382 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55607197 55607422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55608342 55608425 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55608698 55608802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55609219 55609374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (984 nt):
ATGTTGCCCTCCCGGAGGAAAGCGGCGCAGCTGCCCTGGGAGGATGGCAGGGCCAGGTTGCTTCCTGGAG
GC
CTCCGCCGGAAATGCTCCATCTTCCACCTCTTCATTGCCTTTCTCCTGTTGGTCTTCTTCTCCCTGCT
C
TGGCTGCAGCTCAGCTGTTCTGGAGATATGGCCCAGGTGACCAGGGGACAAGGGCAAGAGACCTCGGGT
CCA
CCCCGGGCTTGCCCTCCAGAGCCGCCCCCTGAGCACTGGGAAGAAGATGAGTCCTGGGGGCCCCACC
GC
TTGGCAGTGCTGGTGCCCTTTCGTGAGCGCTTTGAGGAGCTGCTGGTCTTTGTGCCCCACATGCACCG
C
TTCCTAAGCAGGAAGAGGATCCAGCACCACATCTATGTGCTCAACCAGGTGGACCATTTCAGGTTCAAT
CGG
GCAGCACTCATCAATGTGGGCTTCCTGGAGAGCAGCAACAGCACAGACTACATCGCCATGCACGATG
TG
GACCTGCTCCCTCTCAATGAGGAGCTGGACTATGGCTTCCCGGAGGCTGGGCCCTTCCATGTGGCCTC
C
CCAGAGCTCCACCCTCTCTACCACTACAAGACCTATGTGGGCGGCATTCTGCTGCTGTCCAAACAGCAC
TAC
CAGCTGTGCAACGGAATGTCCAACCGCTTTTGGGGCTGGGGCCGAGAGGATGATGAATTCTACCGGC
GC
ATCAAAGGAGCTGGCCTCCAGCTTTTCCGCCCCTCGGGAATCACAACTGGGTACCAGACATTTCGCCA
C
TTGCATGACCCTGCCTGGCGGAAGAGGGACCAAAAACGCATTGCGGCTCAAAAACAGGAACAGTTCAAG
GTG
GACCGGGAGGGAGGCCTGAACACTGTGAAGTACCGGGTGGATTCCCGCACGGCACTGTCTATAGGAG
GG
GCCCCGTGCACTGTCCTCAATGTCATGCTGGACTGCGATAAAACAGCCACCCCATGGTGCATATTTGG
C
TGA


Translation (327 aa):
MLPSRRKAAQLPWEDGRARLLPGGLRRKCSIFHLFIAFLLLVFFSLLWLQLSCSGDMAQVTRGQGQETSG
P
PRACPPEPPPEHWEEDESWGPHRLAVLVPFRERFEELLVFVPHMHRFLSRKRIQHHIYVLNQVDHF
RFN
R
AALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQH
Y
QL
CNGMSNRFWGWGREDDEFYRRIKGAGLQLFRPSGITTGYQTFRHLHDPAWRKRDQKRIAAQKQEQFK
V
DREGGLNTVKYRVDSRTALSIGGAPCTVLNVMLDCDKTATPWCIFG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser