NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26298.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26298.2 Public Mus musculus 13 Hist1h2bp 21 106 86 CCDS HistoryNCBI Gene:319188Re-query CCDS DB by CCDS ID:26298.2Re-query CCDS DB by GeneID:319188See the combined annotation on chromosome 13 in Sequence Viewer

Public Note for CCDS 26298.1
The coding region has been updated to extend the C-terminus to one that is more supported by available transcript and publication data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 26298.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110473 ENSMUSP00000106099 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110473Link to Ensembl Protein Viewer:ENSMUSP00000106099Re-query CCDS DB by Nucleotide ID:ENSMUST00000110473Re-query CCDS DB by Protein ID:ENSMUSP00000106099
Original member Current member EBI,WTSI OTTMUST00000001017 OTTMUSP00000000463 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000001017Link to Vega Protein Viewer:OTTMUSP00000000463Re-query CCDS DB by Nucleotide ID:OTTMUST00000001017Re-query CCDS DB by Protein ID:OTTMUSP00000000463
Original member Current member NCBI NM_178202.2 NP_835509.2 Accepted alive Link to Nucleotide Sequence:NM_178202.2Link to Protein Sequence:NP_835509.2Re-query CCDS DB by Nucleotide ID:NM_178202Re-query CCDS DB by Protein ID:NP_835509Link to BLAST:NP_835509.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_835509.2 138 Q8CGP2-2 138 100% 0 0

Chromosomal Locations for CCDS 26298.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 21787515 21787891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 21789024 21789063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (417 nt):
ATGCCTGAGCCTGTTAAGTCCGTTCCCGCCCCGAAGAAGGGCTCCAAGAAGGCCGTCACCAAGGCCCAAA
AG
AAGGATGGCAAGAAGCGCAAGCGCAGCCGCAAGGAGAGCTACTCGGTGTACGTGTACAAGGTGCTGAA
G
CAAGTGCACCCCGACACCGGCATCTCCTCCAAGGCCATGGGCATCATGAACTCGTTCGTGAACGACATC
TTC
GAGCGCATCGCGAGCGAGGCGTCCCGCCTGGCGCATTACAACAAGCGCTCGACCATCACGTCCCGGG
AG
ATCCAGACGGCCGTGCGCCTGCTGCTGCCCGGGGAGCTGGCCAAGCACGCGGTGTCGGAGGGCACCAA
G
GCTGTCACCAAGTACACCAGCTCCAAAATCCTGTGGAACAAATTCTATTATCTTCCTTCCTTTTAA


Translation (138 aa):
MPEPVKSVPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
F
ERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
KILWNKFYYLPSF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser