NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26135.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26135.1 Public Mus musculus 12 Serpina6 21 106 86 CCDS HistoryNCBI Gene:12401Re-query CCDS DB by CCDS ID:26135.1Re-query CCDS DB by GeneID:12401See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26135.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044159 ENSMUSP00000044033 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044159Link to Ensembl Protein Viewer:ENSMUSP00000044033Re-query CCDS DB by Nucleotide ID:ENSMUST00000044159Re-query CCDS DB by Protein ID:ENSMUSP00000044033
Original member Current member EBI,WTSI OTTMUST00000068452 OTTMUSP00000034618 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000068452Link to Vega Protein Viewer:OTTMUSP00000034618Re-query CCDS DB by Nucleotide ID:OTTMUST00000068452Re-query CCDS DB by Protein ID:OTTMUSP00000034618
Original member Current member NCBI NM_007618.3 NP_031644.1 Accepted alive Link to Nucleotide Sequence:NM_007618.3Link to Protein Sequence:NP_031644.1Re-query CCDS DB by Nucleotide ID:NM_007618Re-query CCDS DB by Protein ID:NP_031644Link to BLAST:NP_031644.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031644.1 397 Q06770 397 100% 0 0

Chromosomal Locations for CCDS 26135.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 103646846 103647031 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 103648578 103648722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 103651690 103651960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 103653897 103654488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1194 nt):
ATGTCGCTCGCCCTGTATACCTGTCTCTTCTGGCTCTGCACCAGTGGCCTCTGGACCACCCAGGCTGTCA
CT
GATGAGGATTCAAGTTCTCACCGAGACCTGGCTCCCACCAATGTTGACTTTGCCTTCAACTTGTACAA
A
CGCCTAGTGGCCCTGAATTCTGACAAGAATACCTTAATCTCCCCAGTGAGCATCTCCATGGCCCTGGCC
ATG
CTGTCCCTAAGCACCAGGGGCTCCACCCAGTATCTCGAGAACCTGGGCTTCAACATGTCAAAGATGT
CT
GAAGCTGAGATCCACCAGGGTTTCCAGTACCTCAATTCCCTTCTCCAGCAGTCTGACACTGGCTTGGA
G
ATGAACATGGGCAATGTCATGTTCCTCCTCCAGAACCTAAAGCTGAAAGACTCATTCTTAGCAGACACC
AAA
CACTATTATGAGTCAGAGGCCTTGACCATCCCTTCCAAGGACTGGACTAAAGCCGGCGAACAGATCA
AC
AATCATGTGAAGAATAAGACACAGGGGAAAATTGAGCATGTGGTCTCAGACCTGGATAGTTCAGCCAC
C
CTCATCCTGATCAACTACATCTTCCTCAAAGGAATATGGAAACTTCCCTTCAGCCCAGAAAATACTAGA
GAG
GAGGACTTCTATGTGAATGAGACAAGCACAGTGAAGGTGCCCATGATGGTCCAGTCAGGCAACATTA
GT
TACTTTCGTGATTCGGCGATCCCCTGCCAGATGGTACAGATGAATTATGTGGGAAATGGAACTACCTT
C
ATCATTCTTCCAGACCAGGGCCAGATGGACACTGTCGTCGCTGCACTTAATCGGGACACAATTGATAGG
TGG
GGCAAGCTTATGATTCCAAGGCAGATGAACCTGTACATCCCCAAATTCTCCATGTCTGATACCTATG
AC
CTTCAAGATGTGCTGGCAGATGTGGGCATTAAGGATTTGTTCACCAACCAATCTGATTTCGCAGACAC
C
ACCAAAGACACTCCCTTGACATTAACGGTACTCCACAAGGCCATGCTGCAACTGGATGAAGGGAATGTG
CTG
CCTGCTGCCACCAATGGCCCTCCTGTACACCTGCCCTCCGAATCATTCACCCTCAAGTACAACAGGC
CC
TTCATCTTCCTGGCCTTTGACAAGTACACATGGAGCAGCCTGATGATGAGCCAAGTCATGAATCCAGC
C
TAA


Translation (397 aa):
MSLALYTCLFWLCTSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALA
M
LSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADT
K
HYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVSDLDSSATLILINYIFLK
GIWKLPFSPENTR
E
EDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIILPDQGQMDTVVAALNRDTIDR
W
GKLMIP
RQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLTVLHKAMLQLDEGNV
L
PAATNGPPVHLPSESFTLKYNRPFIFLAFDKYTWSSLMMSQVMNPA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser