NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26102.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26102.1 Public Mus musculus 12 Ttc8 21 106 86 CCDS HistoryNCBI Gene:76260Re-query CCDS DB by CCDS ID:26102.1Re-query CCDS DB by GeneID:76260See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26102.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000079146 ENSMUSP00000078148 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000079146Link to Ensembl Protein Viewer:ENSMUSP00000078148Re-query CCDS DB by Nucleotide ID:ENSMUST00000079146Re-query CCDS DB by Protein ID:ENSMUSP00000078148
Original member Current member EBI,WTSI OTTMUST00000058183 OTTMUSP00000028154 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000058183Link to Vega Protein Viewer:OTTMUSP00000028154Re-query CCDS DB by Nucleotide ID:OTTMUST00000058183Re-query CCDS DB by Protein ID:OTTMUSP00000028154
Original member Current member NCBI NM_198311.1 NP_938053.1 Accepted alive Link to Nucleotide Sequence:NM_198311.1Link to Protein Sequence:NP_938053.1Re-query CCDS DB by Nucleotide ID:NM_198311Re-query CCDS DB by Protein ID:NP_938053Link to BLink:NP_938053.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_938053.1 515 Q8VD72-1 515 100% 0 0

Chromosomal Locations for CCDS 26102.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 98920670 98920783 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98937120 98937149 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98942218 98942338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98943303 98943366 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98943462 98943621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98943825 98943914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98946569 98946613 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98957281 98957366 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98961402 98961489 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98964497 98964607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98974642 98974781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98975977 98976151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98976427 98976549 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98979802 98979885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 98982458 98982574 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1548 nt):
ATGGGCTCAGAGATGGAGCCACTGCTCCGGGCCTGGAGCTATTTTAGACGCAGGAAGTTCCAGCTCTGCG
CC
GATCTATGCACGCAGATGCTGGAGAAATCCCCTTATGATCAGGAACCAGCTCCTGATTTGCCAGTGTC
T
CAGGCGGCTTGGATTTTGAAAGCACGGGCGCTGACAGAGATGGTGTACATAGATGAAATTGATGTGGAC
CAG
GAAGGAATTGCTGAAATGATCCTGGATGAAAATGCTATTGCTCAGGTCCCACGCCCTGGCACATCTT
TG
AAGCTCCCTGGCACTAACCAAACAGGAGGACCGACTCAAGCTGTCAGGCCAATCACTCAAGCTGGAAG
A
CCCATAACAGGTTTCCTTAGGCCCAGCACACAGAGTGGAAGACCAGGTACAATGGAACAGGCCATCAGA
ACA
CCCAGAACTGCCTACACAGCACGACCTATCACTAGCTCATCTGGAAGATTCGTCAGACTGGGGACTG
CT
TCCATGCTTACAAGTCCCGATGGACCATTTATAAATTTATCTAGACTGAATTTAACAAAATATTCCCA
G
AAGCCTAAGTTGGCAAAGGCTCTATTTGAATATATTCTCCACCATGAAAACGATGTTAAGATGGCTTTG
GAT
TTGGCGTCCCTTTCCACGGAGTATTCTCAGTACAAGGACTGGTGGTGGAAGGTACAGATTGGAAAAT
GT
TACTACAGGTTAGGAATGTACCGTGAAGCAGAGAAACAGTTTAAATCAGCCTTGAAGCAGCAGGAAAT
G
GTAGACACATTTCTCTATCTGGCAAAAGTTTATATCATATTGGATCAACCTGTGACTGCTTTAAATCTA
TTT
AAACAAGGCTTAGATAAGTTTCCAGGAGAGGTGACCCTGCTTTGTGGAATTGCCAGGATCTATGAGG
AA
ATGAATAACAGTTCATCTGCAGCAGAGTACTACAAAGAAGTTCTAAAACAAGACAATACTCACGTGGA
A
GCCATCGCCTGCATTGGAAGCAACCACTTTTATTCTGACCAGCCAGAGGTTGCCCTTCGGTTTTACAGG
CGC
CTCTTGCAGATGGGAGTTTATAACTGCCAGCTTTTCAACAACCTGGGCCTGTGCTGCTTCTATGCCC
AG
CAGTACGATATGACCCTGACCTCGTTTGAACGTGCCCTTTCCCTGGCTGAAAATGAAGAAGAGGCAGC
T
GATGTCTGGTACAACCTGGGGCACATAGCTGTGGGAATCGGAGATACAAACTTGGCCCACCAATGCTTC
AGG
CTGGCCCTGGTCCACAACAACCACCATGCTGAAGCCTACAACAACCTGGCAGTGCTGGAGATGCGGA
AG
GGTCACGTTGAACAGGCACGCGCGCTCTTACAAACCGCATCGTCTTTGGCACCCCACATGTATGAGCC
A
CACTTTAATTTCGCAACAGTCTCTGATAAGATTGGAGATCTTCAGAGAAGCTACGTTGCTGCTCAGAAG
TCT
GAAGTGGCGTTTCCTGAACACGTGGACACACAGCACTTAATTAAGCAGCTGAAGCAGCACTTTGCTA
TG
CTCTGA


Translation (515 aa):
MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVD
Q
EGIAEMILDENAIAQVP
RPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIR
T
PRTAYTARPITSSSGRFVRLGT
ASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMAL
D
LASLSTEYSQYKDWWWKVQIGKCYY
RLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNL
F
KQGLDKFPGEVTLLCGIARIYE
EMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYR
R
LLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAV
GIGDTNLAHQCF
R
LALVHNNHHAEAYNNLAVLEMRKGHVEQ
ARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQK
S
EVAFPEHVDTQHLIKQLKQHFAML




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser