NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25918.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25918.1 Public Mus musculus 12 Nfkbia 21 106 86 CCDS HistoryNCBI Gene:18035Re-query CCDS DB by CCDS ID:25918.1Re-query CCDS DB by GeneID:18035See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 25918.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000021413 ENSMUSP00000021413 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021413Link to Ensembl Protein Viewer:ENSMUSP00000021413Re-query CCDS DB by Nucleotide ID:ENSMUST00000021413Re-query CCDS DB by Protein ID:ENSMUSP00000021413
Original member Current member NCBI NM_010907.2 NP_035037.2 Accepted alive Link to Nucleotide Sequence:NM_010907.2Link to Protein Sequence:NP_035037.2Re-query CCDS DB by Nucleotide ID:NM_010907Re-query CCDS DB by Protein ID:NP_035037Link to BLink:NP_035037.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035037.2 314 Q9Z1E3 314 100% 0 0

Chromosomal Locations for CCDS 25918.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 55489922 55489969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 55490406 55490666 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 55490771 55490859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 55491120 55491330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 55491670 55491778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 55492300 55492526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (945 nt):
ATGTTTCAGCCAGCTGGGCACGGCCAGGACTGGGCCATGGAGGGCCCGCGGGATGGCCTCAAGAAGGAGC
GC
TTGGTGGACGATCGCCACGACAGCGGCCTGGACTCCATGAAGGACGAGGAGTACGAGCAAATGGTGAA
G
GAGCTGCGGGAGATCCGCCTGCAGCCGCAGGAGGCGCCGCTGGCCGCCGAGCCCTGGAAGCAGCAGCTC
ACG
GAGGACGGAGACTCGTTCCTGCACTTGGCAATCATCCACGAAGAGAAGCCGCTGACCATGGAAGTCA
TT
GGTCAGGTGAAGGGAGACCTGGCCTTCCTCAACTTCCAGAACAACCTGCAGCAGACTCCACTCCACTT
G
GCTGTGATCACCAACCAGCCAGGAATTGCTGAGGCACTTCTGAAAGCTGGCTGTGATCCTGAGCTCCGA
GAC
TTTCGAGGAAATACCCCTCTACATCTTGCCTGTGAGCAGGGCTGCCTGGCCAGTGTAGCAGTCTTGA
CG
CAGACCTGCACACCCCAGCATCTCCACTCCGTCCTGCAGGCCACCAACTACAATGGCCACACGTGTCT
G
CACCTAGCCTCTATCCACGGCTACCTGGCCATCGTGGAGCACTTGGTGACTTTGGGTGCTGATGTCAAC
GCT
CAGGAGCCCTGCAATGGCCGGACAGCCCTCCACCTTGCGGTGGACCTGCAGAATCCTGACCTGGTTT
CG
CTCTTGTTGAAATGTGGGGCTGATGTCAACAGGGTAACCTACCAAGGCTACTCCCCCTACCAGCTTAC
C
TGGGGCCGCCCAAGTACCCGGATACAGCAGCAGCTGGGCCAGCTGACCCTGGAAAATCTCCAGATGCTA
CCC
GAGAGCGAGGATGAGGAGAGCTATGACACGGAGTCAGAATTCACAGAGGATGAGCTGCCCTATGATG
AC
TGTGTGTTTGGAGGCCAGCGTCTGACATTATAA


Translation (314 aa):
MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQL
T
EDGD
SFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELR
D
FRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYN
GHTCLHLASIHGYLAIVEHLVTLGADVN
A
Q
EPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQML
P
ESEDEESYDTESEFTEDE
LPYDDCVFGGQRLTL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser