NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25571.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25571.1 Public Mus musculus 11 Cacng4 23 108 98 CCDS HistoryNCBI Gene:54377Re-query CCDS DB by CCDS ID:25571.1Re-query CCDS DB by GeneID:54377See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25571.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000021066.3 ENSMUSP00000021066.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021066.3Link to Ensembl Protein Viewer:ENSMUSP00000021066.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000021066Re-query CCDS DB by Protein ID:ENSMUSP00000021066
Original member Current member NCBI NM_019431.4 NP_062304.1 Accepted alive Link to Nucleotide Sequence:NM_019431.4Link to Protein Sequence:NP_062304.1Re-query CCDS DB by Nucleotide ID:NM_019431Re-query CCDS DB by Protein ID:NP_062304Link to BLAST:NP_062304.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062304.1 327 Q9JJV4 327 100% 0 0

Chromosomal Locations for CCDS 25571.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 107734780 107735318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 107736727 107736867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 107741921 107742004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 107794245 107794464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (984 nt):
ATGGTGCGATGCGACCGCGGGCTGCAGATGCTGCTGACCACGGCCGGAGCCTTCGCCGCCTTCTCGCTCA
TG
GCCATCGCCATCGGCACCGACTACTGGCTGTACTCCAGCGCGCACATCTGCAACGGCACCAACCTGAC
C
ATGGACGACGGGCCCCCGCCCCGCCGCGCTCGCGGCGACCTCACCCATTCGGGACTGTGGCGGGTGTGT
TGC
ATCGAAGGCATCTATAGAGGGCACTGCTTCCGGATCAACCACTTCCCAGAGGACAATGATTACGACC
AC
GACAGCTCCGAGTACCTCCTCCGCATTGTGCGAGCCTCCAGTGTCTTTCCCATCCTCAGCACCATTCT
G
CTCCTGCTCGGAGGGCTCTGCATCGGCGCTGGGAGGATCTACAGCCGCAAGAACAATATTGTCCTCAGC
GCG
GGAATCCTCTTTGTGGCGGCAGGCCTCAGTAATATCATCGGTATCATCGTCTACATTTCCAGCAACA
CG
GGCGACCCCAGTGACAAACGTGACGAAGACAAAAAGAACCATTACAACTACGGCTGGTCTTTTTACTT
T
GGAGCCCTGTCGTTTATTGTGGCGGAGACCGTGGGCGTCCTGGCTGTAAACATTTACATTGAGAAAAAT
AAA
GAGTTGAGGTTTAAGACCAAGCGGGAGTTCCTTAAGGCCTCTTCCTCCTCTCCTTACGCCAGGATGC
CG
AGCTACAGGTACCGGCGACGGCGGTCCAGGTCCAGTTCAAGGTCCACGGAGGCCTCACCCTCCAGGGA
T
GCATCTCCCGTGGGCCTGAAGATCACCGGAGCCATTCCCATGGGTGAGCTGTCCATGTACACGCTATCC
AGA
GAACCCCTTAAGGTGACCACAGCTGCGAGCTACAGTCCGGACCAGGACGCTGGCTTCCTGCAGATGC
AT
GACTTCTTCCAACAGGACCTAAAGGAAGGTTTCCATGTCAGCATGCTGAACCGGCGGACGACTCCCGT
G
TGA


Translation (327 aa):
MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVC
C
IE
GIYRGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLS
A
GILFVAA
GLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKN
K
ELRFKTKREFLKASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDASPVGLKITGAIPMGELSMYTLS
R
EPLKVTTAASYSPDQDAGFLQMHDFFQQDLKEGFHVSMLNRRTTPV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser