NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25550.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25550.1 Public Mus musculus 11 Strada 21 106 86 CCDS HistoryNCBI Gene:72149Re-query CCDS DB by CCDS ID:25550.1Re-query CCDS DB by GeneID:72149See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25550.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000103072 ENSMUSP00000099361 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000103072Link to Ensembl Protein Viewer:ENSMUSP00000099361Re-query CCDS DB by Nucleotide ID:ENSMUST00000103072Re-query CCDS DB by Protein ID:ENSMUSP00000099361
Original member Current member EBI,WTSI OTTMUST00000006680 OTTMUSP00000003173 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000006680Link to Vega Protein Viewer:OTTMUSP00000003173Re-query CCDS DB by Nucleotide ID:OTTMUST00000006680Re-query CCDS DB by Protein ID:OTTMUSP00000003173
Original member Current member NCBI NM_028126.3 NP_082402.1 Accepted alive Link to Nucleotide Sequence:NM_028126.3Link to Protein Sequence:NP_082402.1Re-query CCDS DB by Nucleotide ID:NM_028126Re-query CCDS DB by Protein ID:NP_082402Link to BLAST:NP_082402.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082402.1 394 Q3UUJ4-3 394 100% 0 0

Chromosomal Locations for CCDS 25550.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 106164039 106164191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106164431 106164473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106164720 106164961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106167812 106167916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106168309 106168480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106170954 106171077 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106171156 106171264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106173253 106173374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106173679 106173781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 106187125 106187136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1185 nt):
ATGTCTTTTCTTGCCAATGAGGCGAGCTCAGAGTCCATAGCATCTTTCTCCAAACCAGAGATGATGAGCA
GC
TTTCTTCCAGAGGGCGGGTGTTATGAGCTGCTCACCATCATAGGCAAAGGGTTTGAGGACTTGATGAC
A
GTGAATTTAGCCAGGTACAAACCAACGGGAGAGTATGTGACAGTACGAAGGATCAACCTAGAAGCTTGT
TCC
AATGAGATGGTGACATTCTTGCAGGGGGAGCTTCATGTCTCTAAACTCTTCAGCCATCCCAATATAG
TA
CCGTATCGAGCCACCTTCATCGCAGATAATGAGCTGTGGGTCGTCACATCATTTATGGCGTACGGCTC
T
GCAAAGGATCTCATTGGCACACACTTCATGGATGGCATGAATGAACTGGCGATTGCATACATCCTGCAG
GGG
GTGCTAAAGGCCTTAGACTACATCCATCACATGGGCTATGTGCACAGGAGTGTCAAGGCCAGCCACA
TT
CTGATCTCCACGGATGGGAAGGTCTACCTGTCTGGTTTACGCAGCAACCTTAGCATGATTAGTCACGG
G
CAGCGGCAGCGTGCAGTCCACGATTTCCCCAAATATAGTATCAAGGTCCTGCCTTGGCTCAGCCCAGAA
GTC
CTCCAGCAGAATCTTCAGGGTTACGATGCCAAGTCCGATATCTACAGTGTGGGAATCACAGCATGTG
AA
CTAGCCAATGGCCATGTCCCCTTCAAAGATATGCCTGCCACTCAGATGCTGCTAGAAAAACTTAATGG
C
ACAGTGCCCTGCCTGCTGGACACCAGCACCATCCCTGCCGAGGAGCTGACCATGAGTCCCTCCCGCTCC
ATC
GCCAACCCTGGCCTGAATGACAGCCTGGCTGCTGGTAGCCTCCGGCCTTCCAATGGCGACTCGCCTT
CC
CACCCCTACCACCGAACCTTCTCGCCTCACTTCCACAACTTTGTGGAACAGTGCCTTCAGCGCAACCC
T
GACGCAAGGCCAAACGCCAGCACCCTGCTGAACCACTCCTTCTTCAAGCAGATCAAGCGGCGTGCTTCC
GAG
GCTTTGCCTGAGTTGCTCCGCCCAGTCACTCCCATCACCAACTTCGAGGGCAGCCAGTCTCAGGATC
AC
AGTGGAATCTTCGGCCTGGTGACAAACCTAGAAGACCTGGAGGTGGATGACTGGGAGTTCTGA


Translation (394 aa):
MSFLANEASSESIASFSKPEMMSSFLPEGGCYELLTIIGKGFEDLMTVNLARYKPTGEYVTVRRINLEAC
S
NEMVTFLQ
GELHVSKLFSHPNIVPYRATFIADNELWVVTSFMAYGSAKDLIGTHFMDGMNELAIAYILQ
G
VLKALDYIHHMGYVH
RSVKASHILISTDGKVYLSGLRSNLSMISHGQRQRAVHDFPKYSIKVLPWLSPE
V
LQQ
NLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRS
I
ANPGLNDSLAAGSLRPSNGDSPSHPYHRTFSPHFHNFVEQCLQRNPDA
RPNASTLLNHSFFKQIKRRAS
E
ALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEDLEVDDWEF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser