NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25349.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25349.1 Public Mus musculus 11 Erbb2 19 105 81 CCDS HistoryNCBI Gene:13866Re-query CCDS DB by CCDS ID:25349.1Re-query CCDS DB by GeneID:13866See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25349.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000058295 ENSMUSP00000053897 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058295Link to Ensembl Protein Viewer:ENSMUSP00000053897Re-query CCDS DB by Nucleotide ID:ENSMUST00000058295Re-query CCDS DB by Protein ID:ENSMUSP00000053897
Original member Current member EBI,WTSI OTTMUST00000005365 OTTMUSP00000002540 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000005365Link to Vega Protein Viewer:OTTMUSP00000002540Re-query CCDS DB by Nucleotide ID:OTTMUST00000005365Re-query CCDS DB by Protein ID:OTTMUSP00000002540
Original member Current member NCBI NM_001003817.1 NP_001003817.1 Accepted alive Link to Nucleotide Sequence:NM_001003817.1Link to Protein Sequence:NP_001003817.1Re-query CCDS DB by Nucleotide ID:NM_001003817Re-query CCDS DB by Protein ID:NP_001003817Link to BLink:NP_001003817.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001003817.1 1256 P70424 1256 100% 0 0

Chromosomal Locations for CCDS 25349.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 98412663 98412735 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98420089 98420240 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98420865 98421081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98422055 98422189 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98422524 98422592 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98422755 98422870 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98422995 98423136 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98424740 98424859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98425097 98425223 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98426903 98426976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98427060 98427150 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98427256 98427455 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98427914 98428046 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98428136 98428226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98428824 98428984 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98431717 98431764 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98432911 98433049 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98433131 98433253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98433399 98433497 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98433892 98434077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98434214 98434369 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98434500 98434575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98434802 98434948 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98435275 98435372 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98435525 98435713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98435929 98436181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98436313 98436668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3771 nt):
ATGGAGCTGGCGGCCTGGTGCCGTTGGGGGTTCCTCCTCGCCCTCCTGTCCCCCGGAGCCGCGGGTACCC
AA
GTGTGTACCGGTACCGACATGAAGTTGCGACTCCCTGCCAGTCCTGAGACCCACCTGGACATGCTTCG
C
CACCTCTACCAGGGCTGTCAGGTGGTGCAGGGCAATTTGGAGCTTACCTACCTGCCCGCCAATGCCAGC
CTC
TCATTCCTGCAGGACATCCAGGAAGTCCAGGGATACATGCTCATCGCTCACAACCGAGTGAAACACG
TC
CCACTGCAGAGGTTGCGCATCGTGAGAGGGACTCAGCTCTTTGAGGACAAGTATGCCCTGGCTGTGCT
A
GACAACCGAGACCCTTTGGACAACGTCACCACCGCCGCCCCAGGCAGAACCCCAGAAGGGCTGCGGGAG
CTG
CAGCTTCGAAGTCTCACAGAGATCTTGAAGGGAGGAGTTTTGATCCGTGGGAACCCTCAGCTCTGCT
AC
CAGGACATGGTTTTGTGGAAGGATGTCCTCCGTAAGAATAACCAGCTGGCTCCTGTCGACATGGACAC
C
AATCGTTCCCGGGCCTGTCCACCTTGTGCCCCAACCTGCAAAGACAATCACTGTTGGGGTGAGAGTCCT
GAA
GACTGTCAGATCTTGACTGGCACCATCTGTACTAGTGGCTGTGCCCGGTGCAAGGGCCGGCTGCCCA
CT
GACTGTTGCCATGAGCAGTGTGCTGCAGGCTGCACGGGTCCCAAGCATTCTGACTGCCTGGCCTGCCT
C
CACTTCAATCATAGTGGTATCTGTGAGCTGCACTGCCCGGCCCTCATCACCTACAACACAGACACCTTC
GAG
TCCATGCTCAACCCTGAGGGTCGCTACACCTTTGGTGCCAGCTGTGTGACCACCTGCCCCTACAACT
AC
CTCTCCACGGAAGTGGGATCCTGCACTCTGGTCTGTCCCCCGAACAACCAAGAGGTCACAGCTGAGGA
C
GGAACACAGCGGTGTGAGAAATGCAGCAAGCCCTGTGCTGGAGTATGCTATGGTCTGGGCATGGAGCAC
CTC
CGAGGGGCGAGGGCCATCACCAGTGACAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGA
GC
CTGGCATTTTTGCCGGAGAGCTTTGATGGGAACCCCTCCTCCGGCGTTGCCCCACTGAAGCCAGAGCA
T
CTCCAAGTGTTCGAAACCCTGGAGGAGATCACAGGTTACCTATACATTTCAGCATGGCCAGAGAGCTTC
CAA
GACCTCAGTGTCTTCCAGAACCTTCGGGTCATTCGGGGACGGATTCTCCATGATGGTGCTTACTCAT
TG
ACGTTGCAAGGCCTGGGGATTCACTCACTGGGGCTACGCTCACTGCGGGAGCTGGGCAGTGGATTGGC
T
CTCATTCACCGCAACACCCATCTCTGCTTTGTAAACACTGTACCTTGGGACCAGCTCTTCCGGAACCCG
CAC
CAGGCCCTACTCCACAGTGGGAACCGGCCAGAAGAGGCATGTGGTCTTGAGGGCTTGGTCTGTAACT
CA
CTGTGTGCCCGTGGGCACTGCTGGGGGCCAGGGCCCACCCAGTGTGTCAACTGCAGTCAGTTCCTCCG
G
GGCCAGGAGTGTGTGGAGGAGTGCCGAGTATGGAAGGGGCTCCCCAGGGAGTATGTGAGGGGCAAGCAC
TGT
CTGCCATGCCACCCCGAGTGTCAGCCTCAAAACAGCTCGGAGACCTGCTATGGATCGGAGGCTGACC
AG
TGTGAGGCTTGTGCCCACTACAAGGACTCATCTTCCTGTGTGGCTCGCTGCCCCAGTGGTGTGAAGCC
A
GACCTCTCCTACATGCCTATCTGGAAGTACCCGGATGAGGAGGGCATATGTCAGCCATGCCCCATCAAC
TGC
ACCCACTCATGTGTGGACCTGGACGAACGAGGCTGCCCAGCAGAGCAGAGAGCCAGCCCAGTGACAT
TC
ATCATTGCAACTGTGGTGGGCGTCCTGTTGTTCCTGATCATAGTGGTGGTCATTGGAATCCTAATCAA
A
CGAAGGCGACAGAAGATCCGGAAGTATACCATGCGTAGGCTGCTGCAGGAGACCGAGCTGGTGGAGCCG
CTG
ACGCCCAGTGGAGCTGTGCCCAACCAGGCTCAGATGCGGATCCTAAAGGAGACAGAGCTAAGGAAGC
TG
AAGGTGCTTGGGTCAGGAGCCTTCGGCACTGTCTACAAGGGCATCTGGATCCCAGATGGGGAGAACGT
G
AAAATCCCCGTGGCCATCAAGGTGTTGAGGGAAAACACATCTCCTAAAGCTAACAAAGAAATCCTAGAT
GAA
GCGTACGTCATGGCTGGTGTGGGTTCTCCATATGTGTCCCGCCTCCTGGGCATCTGCCTGACATCCA
CA
GTGCAGCTGGTGACACAGCTTATGCCCTATGGCTGCCTTCTGGACCATGTCCGAGAACACCGAGGTCG
C
TTAGGCTCCCAGGACCTGCTCAACTGGTGTGTTCAGATTGCCAAGGGGATGAGCTACCTGGAGGAAGTT
CGG
CTTGTTCACAGGGACCTAGCTGCCCGAAACGTGCTAGTCAAGAGTCCCAACCACGTCAAGATTACCG
AC
TTCGGGCTGGCACGGCTGCTGGACATTGATGAGACTGAATACCATGCAGATGGGGGCAAGGTGCCCAT
C
AAGTGGATGGCATTGGAATCTATTCTCAGACGCCGGTTCACCCATCAGAGTGATGTGTGGAGCTATGGT
GTG
ACTGTGTGGGAGCTGATGACCTTTGGGGCCAAACCTTACGATGGGATCCCAGCTCGGGAGATCCCTG
AT
TTGCTGGAGAAGGGAGAACGCCTACCTCAGCCTCCAATCTGCACCATCGACGTCTACATGATCATGGT
C
AAATGTTGGATGATTGACTCCGAATGTCGCCCGAGATTCCGGGAGTTGGTATCAGAATTCTCCCGTATG
GCA
AGGGACCCCCAGCGCTTTGTGGTCATCCAGAACGAGGACTTAGGCCCCTCCAGCCCCATGGACAGCA
CC
TTCTACCGTTCACTGCTGGAGGATGATGACATGGGGGAGCTGGTCGATGCTGAAGAGTACCTGGTACC
C
CAGCAGGGATTCTTCTCCCCAGACCCTGCCCTAGGTACTGGGAGCACAGCCCACCGCAGACACCGCAGC
TCG
TCGGCCAGGAGTGGCGGTGGTGAGCTGACACTGGGCCTGGAGCCCTCGGAAGAAGAGCCCCCCAGAT
CT
CCACTGGCTCCCTCCGAAGGGGCTGGCTCCGATGTGTTTGATGGTGACCTGGCAGTGGGGGTAACCAA
A
GGACTGCAGAGCCTCTCTCCACATGACCTCAGCCCTCTACAGCGGTACAGTGAGGATCCCACATTACCT
CTG
CCCCCCGAGACTGATGGCTACGTTGCTCCCCTGGCCTGCAGCCCCCAGCCCGAGTATGTGAACCAGC
CA
GAGGTTCGGCCTCAGTCTCCCTTGACCCCAGAGGGTCCTCCGCCTCCCATCCGACCTGCTGGTGCTAC
T
CTAGAAAGACCCAAGACTCTCTCTCCTGGGAAAAATGGGGTTGTCAAAGACGTTTTTGCCTTTGGGGGT
GCT
GTGGAGAACCCTGAATACTTAGCACCCAGAGCAGGCACTGCCTCTCAGCCCCACCCTTCTCCTGCCT
TC
AGCCCAGCCTTTGACAACCTCTATTACTGGGACCAGAACTCATCGGAGCAGGGTCCTCCACCAAGTAC
C
TTTGAAGGGACCCCCACTGCAGAGAACCCTGAGTACCTAGGCCTGGATGTGCCAGTATGA


Translation (1256 aa):
MELAAWCRWGFLLALLSPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPANAS
L
SFLQ
DIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQLFEDKYALAVLDNRDPLDNVTTAAPGRTPEGLRE
L
QLRSLT
EILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQLAPVDMDTNRSRACPPCAPTCKDNHCWGESP
E
DCQI
LTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTF
E
SMLNPEGRYTFGASCVTTCP
YNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAGVCYGLGMEH
L
RGARAITSDNIQEFAGCKKIFGSLAFLPESFD
GNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPESF
Q
DLSVFQNLRVIRGRILH
DGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNTVPWDQLFRNP
H
QALLHSGNRPEEAC
GLEGLVCNSLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVWKGLPREYVRGKH
C
LPCHPECQPQNSSETCYGS
EADQCEACAHYKDSSSCVARCPSGVKPDLSYMPIWKYPDEEGICQPCPIN
C
TH
SCVDLDERGCPAEQRASPVTFIIATVVGVLLFLIIVVVIGILIKRRRQKIRKYTMRRLLQETELVEP
L
TPSGAVPNQAQMRILKETELRKLKVLGSGAFGTVYK
GIWIPDGENVKIPVAIKVLRENTSPKANKEILD
E
AYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAK
GMSYLEEV
R
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGK
VPIKWMALESILRRRFTHQSDVWSYG
V
TVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVK
CWMIDSECRPRFRELVSEFSRM
A
RDPQRFVVIQ
NEDLGPSSPMDSTFYRSLLEDDDMGELVDAEEYLVPQQGFFSPDPALGTGSTAHRRHRS
S
SAR
SGGGELTLGLEPSEEEPPRSPLAPSEGAGSDVFDGDLAVGVTKGLQSLSPHDLSPLQRYSEDPTLP
L
PPETDGYVAPLACSPQP
EYVNQPEVRPQSPLTPEGPPPPIRPAGATLERPKTLSPGKNGVVKDVFAFGG
A
VENPEYLAPRAGTASQPHPSPAFSPAFDNLYYWDQNSSEQGPPPSTFEGTPTAENPEYLGLDVPV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser