NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25316.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25316.1 Public Mus musculus 11 Kpnb1 21 106 86 CCDS HistoryNCBI Gene:16211Re-query CCDS DB by CCDS ID:25316.1Re-query CCDS DB by GeneID:16211See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25316.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000001479 ENSMUSP00000001479 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000001479Link to Ensembl Protein Viewer:ENSMUSP00000001479Re-query CCDS DB by Nucleotide ID:ENSMUST00000001479Re-query CCDS DB by Protein ID:ENSMUSP00000001479
Original member Current member EBI,WTSI OTTMUST00000004585 OTTMUSP00000002199 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000004585Link to Vega Protein Viewer:OTTMUSP00000002199Re-query CCDS DB by Nucleotide ID:OTTMUST00000004585Re-query CCDS DB by Protein ID:OTTMUSP00000002199
Original member Current member NCBI NM_008379.3 NP_032405.3 Accepted alive Link to Nucleotide Sequence:NM_008379.3Link to Protein Sequence:NP_032405.3Re-query CCDS DB by Nucleotide ID:NM_008379Re-query CCDS DB by Protein ID:NP_032405Link to BLAST:NP_032405.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032405.3 876 P70168 876 100% 0 0

Chromosomal Locations for CCDS 25316.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 97162681 97162681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97163353 97163514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97163914 97164028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97164725 97164830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97164953 97165096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97165376 97165483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97166047 97166129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97167550 97167694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97168865 97168936 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97169148 97169295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97169902 97170032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97171522 97171713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97173053 97173277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97175749 97175850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97177246 97177356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97178270 97178359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97178868 97178927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97180444 97180596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97181625 97181825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97184927 97185109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97187389 97187447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 97187546 97187585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2631 nt):
ATGGAGCTCATAACCATCCTCGAGAAGACCGTGTCTCCGGATCGGCTGGAGCTGGAAGCGGCGCAGAAGT
TC
CTCGAGCGTGCGGCCGTGGAGAATCTGCCCACGTTCCTTGTGGAACTGTCCAGAGTGCTGGCAAACCC
A
GGAAACAGTCAGGTTGCCAGAGTTGCAGCTGGTCTACAAATTAAGAACTCTTTGACATCGAAAGATCCA
GAT
ATCAAGGCACAATACCAGCAGAGGTGGCTCGCTATTGATGCTAATGCTCGACGGGAAGTCAAGAACT
AT
GTTTTGCAGACGTTGGGCACAGAAACGTACCGGCCTAGTTCGGCCTCACAGTGTGTGGCTGGTATTGC
T
TGTGCAGAGATCCCAGTAAGCCAGTGGCCAGAGCTAATTCCTCAGCTGGTAGCCAATGTCACAAACCCC
AAC
AGCACAGAGCATATGAAAGAGTCCACATTGGAAGCTATTGGTTACATTTGCCAAGATATAGACCCAG
AG
CAGCTACAGGATAAGTCCAATGAGATCCTGACTGCCATAATCCAGGGGATGAGGAAGGAGGAGCCTAG
T
AACAATGTGAAGCTGGCTGCTACCAATGCACTCCTGAACTCACTAGAGTTCACCAAAGCAAACTTTGAC
AAA
GAGTCTGAAAGGCACTTTATCATGCAAGTGGTCTGTGAAGCCACACAGTGTCCAGACACAAGGGTAA
GA
GTGGCTGCTTTACAGAATCTAGTGAAGATAATGTCCTTGTATTACCAGTACATGGAGACATACATGGG
T
CCTGCCCTTTTTGCAATCACAATTGAAGCAATGAAAAGTGACATTGATGAGGTGGCTCTCCAAGGGATA
GAG
TTCTGGTCCAATGTCTGTGATGAGGAAATGGATTTGGCCATTGAGGCTTCAGAGGCAGCAGAGCAAG
GA
CGCCCCCCGGAGCACACCAGCAAATTTTACGCCAAGGGAGCACTGCAGTACTTGGTGCCCATCCTCAC
A
CAGACACTGACTAAACAGGATGAAAACGATGACGACGATGACTGGAACCCTTGCAAAGCAGCTGGGGTG
TGC
CTCATGCTCCTGTCCACCTGCTGTGAAGATGACATTGTGCCGCATGTCCTTCCCTTTATTAAAGAGC
AC
ATCAAGAACCCTGACTGGCGATACCGGGATGCAGCAGTGATGGCTTTTGGCAGTATCTTGGAAGGACC
A
GAGCCTAATCAACTGAAACCATTAGTCATACAGGCTATGCCCACCCTAATAGAACTAATGAAAGACCCC
AGT
GTAGTTGTTCGAGACACAACAGCGTGGACTGTGGGCAGGATCTGTGAGCTGCTGCCTGAAGCCGCCA
TC
AACGATGTCTACCTGGCACCCCTTTTACAGTGTCTGATTGAGGGCCTCAGTGCTGAGCCCAGGGTGGC
T
TCAAATGTGTGCTGGGCTTTTTCCAGTCTGGCTGAAGCTGCGTATGAAGCTGCAGATGTAGCTGATGAT
CAA
GAAGAACCAGCCACCTATTGTCTGTCTTCTTCCTTTGAACTTATAGTTCAGAAGCTATTGGAGACCA
CC
GACAGACCCGATGGACACCAGAATAACCTGAGAAGCTCTGCGTATGAGTCTCTCATGGAAATCGTAAA
G
AACAGTGCCAAGGATTGTTACCCTGCCGTGCAGAAGACCACCCTGGTCATTATGGAACGGCTGCAGCAG
GTG
CTTCAGATGGAGTCCCATATCCAGAGCACATCCGACAGAATCCAGTTCAATGACCTCCAGTCTCTAC
TC
TGCGCGACTCTTCAGAATGTTCTCCGGAAAGTGCAGCATCAAGATGCTCTGCAGATCTCTGATGTGGT
C
ATGGCCTCCCTGTTAAGGATGTTCCAAAGCACAGCTGGGTCTGGGGGAGTGCAAGAAGATGCCCTGATG
GCA
GTTAGCACACTGGTGGAAGTGTTGGGTGGTGAATTCCTCAAGTACATGGAGGCCTTTAAACCATTCC
TG
GGCATTGGACTGAAAAATTATGCTGAGTACCAGGTATGTTTGGCAGCTGTTGGCTTAGTTGGAGACTT
G
TGCCGAGCCCTGCAGTCTAACATCTTGCCTTTCTGTGACGAGGTGATGCAGCTGCTCCTGGAGAACTTG
GGG
AATGAGAATGTCCACAGGTCTGTGAAGCCACAGATTCTGTCTGTGTTTGGTGATATTGCTCTTGCCA
TT
GGTGGAGAGTTTAAAAAATACTTAGAGGTTGTATTGAATACTCTACAGCAGGCCTCCCAAGCCCAGGT
T
GACAAGTCAGACTTTGACATGGTGGATTATCTGAATGAGCTAAGAGAAAGCTGCTTGGAAGCTTATACG
GGA
ATCGTCCAGGGATTGAAGGGAGATCAGGAAAACGTACACCCGGATGTAATGCTGGTACAGCCCAGAG
TA
GAATTTATTTTGTCTTTTATTGATCACATTGCTGGAGATGAGGATCATACGGACGGAGTGGTAGCCTG
T
GCTGCTGGTCTGATAGGGGACTTGTGTACAGCCTTCGGGAAGGATGTACTGAAGTTAGTAGAAGCTAGG
CCA
ATGATCCATGAACTATTAACTGAAGGGCGGAGATCGAAGACTAACAAAGCAAAGACCCTCGCTACGT
GG
GCAACCAAGGAACTGAGGAAACTGAAGAACCAGGCTTGA


Translation (876 aa):
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDP
D
IKAQYQQRWLAIDANARREVKNY
VLQTLGTETYRPSSASQCVAGIACAEIPVSQWPELIPQLVANVTNP
N
STEHMKESTLEAIGYICQDI
DPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFD
K
E
SERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGI
E
FWSNVCDEEMDLAIEASE
AAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGV
C
LMLLSTCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGSILEGPEPNQLKPLVIQ
AMPTLIELMKDP
S
VVVRDTTAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCW
AFSSLAEAAYEAADVADD
Q
EEPATYCLSSSFELIVQKLLETTD
RPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQ
V
LQME
SHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALM
A
VSTLVE
VLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNILPFCDEVMQLLLENL
G
NENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDFDMVDYLNELRESCLEAYT
G
IVQGLKGDQENVH
PDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR
P
MIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser